UTP3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: UTP3 Antibody [NBP1-85449] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: UTP3 Antibody [NBP1-85449] - Staining of human cerebellum shows strong nucleolar positivity in purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UTP3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UTP3 Antibody - BSA Free (NBP1-85449) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-UTP3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQ
• Predicted Species: Mouse (90%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UTP3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  UTP3 Protein (NBP1-85449PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UTP3 Antibody - BSA Free

• Charged amino acid-rich leucine zipper 1
• CRL1charged amino acid rich leucine zipper 1 homolog
• CRLZ1UTP3 homolog
• disrupter of silencing 10
• Disrupter of silencing SAS10
• FLJ23256
• SAS10DKFZp761F222
• something about silencing protein 10
• UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)

Background

SAS10 (something about silencing 10) was originally identified in a screen for yeast genes that distrupted gene silencing when overexpressed . Alternative names for SAS10 include UTP3 homolog, disrupter of silencing SAS10, charged amino acid-rich leucine zipper 1, and CRLZ1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UTP3 Antibody (NBP1-85449)(1)

Publication using NBP1-85449

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: UTP3