USP46 Antibody - BSA Free

Western Blot: USP46 Antibody [NBP3-35794] - Western blot analysis of lysates from mouse pancreas, using USP46 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: USP46 Antibody [NBP3-35794] - Immunofluorescence analysis of C6 cells using USP46 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: USP46 Antibody [NBP3-35794] - Immunofluorescence analysis of L-929 cells using USP46 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USP46 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USP46 Antibody - BSA Free (NBP3-35794) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human USP46 (NP_073743.2).
  
  Sequence:
  KKFISRLRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP46
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for USP46 Antibody - BSA Free

• Deubiquitinating enzyme 46
• EC 3.1.2.15
• EC 3.4.19.12
• FLJ11850
• FLJ12552
• FLJ14283
• FLJ39393
• ubiquitin carboxyl-terminal hydrolase 46
• ubiquitin specific peptidase 46
• ubiquitin specific protease 46
• ubiquitin thioesterase 46
• Ubiquitin thiolesterase 46
• Ubiquitin-specific-processing protease 46
• USP46

Background

Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinatedaction of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP46 belongs to a large family of cysteineproteases that function as deubiquitinating enzymes (Quesada et al., 2004 (PubMed 14715245)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP46