KSR2 Antibody (1G4) - Azide and BSA Free

Western Blot: KSR2 Antibody (1G4) [H00283455-M08] - Analysis of KSR2 expression in A-431.

Western Blot: KSR2 Antibody (1G4) [H00283455-M08] - Western Blot analysis of KSR2 expression in K-562 ( Cat # L009V1 ).

Western Blot: KSR2 Antibody (1G4) [H00283455-M08] - Western blot analysis of KSR2 over-expressed 293 cell line, cotransfected with KSR2 Validated Chimera RNAi or non-transfected control. Blot probed with H00283455-M08. GAPDH (36.1 kDa) used as loading control.

Western Blot: KSR2 Antibody (1G4) [H00283455-M08] - Analysis of KSR2 expression in transfected 293T cell line by KSR2 monoclonal antibody (M08), clone 1G4. Lane 1: KSR2 transfected lysate (Predicted MW: 93.6 KDa). Lane 2: Non-transfected lysate.

ELISA: KSR2 Antibody (1G4) [H00283455-M08] - Detection limit for recombinant GST tagged KSR2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, KD
• Clone: 1G4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KSR2 Antibody (1G4) - Azide and BSA Free Summary

• Immunogen: KSR2 (NP_775869, 411 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAPPLPPSATPPSPLHPSPQCTRQQKNFNLPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEV
• Specificity: KSR2 - kinase suppressor of ras 2
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KSR2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KSR2 Antibody (1G4) - Azide and BSA Free

• FLJ25965
• hKSR2
• kinase suppressor of ras 2
• kinase suppressor of Ras-2

Background

Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediatedsignaling. Acts as a negative regulator of MAP3K3-mediated activation of ERK, JNK and NF-kappa-B pathways, inhibitingMAP3K3-mediated interleukin-8 production

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KSR2 Antibody (H00283455-M08)(4)

Publications using H00283455-M08

• Chao G, Si-Wei W, Jia-Cheng L et al. KSR2-14-3-3? complex serves as a biomarker and potential therapeutic target in sorafenib-resistant hepatocellular carcinoma. Biomark Res. 2022-04-25 [PMID: 35468812]
• Gonzalez de Valdivia E, Broselid S, Kahn R et al. G protein-coupled Estrogen Receptor 1 (GPER1)/GPR30 Increases ERK1/2 Activity Through PDZ-dependent and -independent Mechanisms. J Biol Chem 2017-04-27 [PMID: 28450397]
• Fernandez MR, Henry MD, Lewis RE. Kinase Suppressor of Ras-2 (KSR2) Regulates Tumor Cell Transformation Via AMPK. Mol Cell Biol. 2012-07-16 [PMID: 22801368]
• Costanzo-Garvey DL, Pfluger PT, Dougherty MK et al. KSR2 is an essential regulator of AMP kinase, energy expenditure, and insulin sensitivity. Cell Metab 10(5):366-78. 2009-11-01 [PMID: 19883615]

Bioinformatics

• Gene Symbol: KSR2
• Entrez:
  • 283455(Human)
• Uniprot:
  • NP_775869(Human)