KSR2 Antibody (1G4) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse KSR2 Antibody (1G4) - Azide and BSA Free (H00283455-M08) is a monoclonal antibody validated for use in WB and ELISA. Anti-KSR2 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
KSR2 (NP_775869, 411 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PAPPLPPSATPPSPLHPSPQCTRQQKNFNLPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEV |
| Specificity |
KSR2 - kinase suppressor of ras 2 |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
KSR2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:100-1:2000
- Knockdown Validated
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for KSR2 Antibody (1G4) - Azide and BSA Free
Background
Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediatedsignaling. Acts as a negative regulator of MAP3K3-mediated activation of ERK, JNK and NF-kappa-B pathways, inhibitingMAP3K3-mediated interleukin-8 production
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ChIP, ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: WB, ELISA, Mycoplasma
Publications for KSR2 Antibody (H00283455-M08)(4)
Showing Publications 1 -
4 of 4.
| Publications using H00283455-M08 |
Applications |
Species |
| Chao G, Si-Wei W, Jia-Cheng L et al. KSR2-14-3-3? complex serves as a biomarker and potential therapeutic target in sorafenib-resistant hepatocellular carcinoma. Biomark Res. 2022-04-25 [PMID: 35468812] |
|
|
| Gonzalez de Valdivia E, Broselid S, Kahn R et al. G protein-coupled Estrogen Receptor 1 (GPER1)/GPR30 Increases ERK1/2 Activity Through PDZ-dependent and -independent Mechanisms. J Biol Chem 2017-04-27 [PMID: 28450397] |
|
|
| Fernandez MR, Henry MD, Lewis RE. Kinase Suppressor of Ras-2 (KSR2) Regulates Tumor Cell Transformation Via AMPK. Mol Cell Biol. 2012-07-16 [PMID: 22801368] |
|
|
| Costanzo-Garvey DL, Pfluger PT, Dougherty MK et al. KSR2 is an essential regulator of AMP kinase, energy expenditure, and insulin sensitivity. Cell Metab 10(5):366-78. 2009-11-01 [PMID: 19883615] |
|
|
Reviews for KSR2 Antibody (H00283455-M08) (0)
There are no reviews for KSR2 Antibody (H00283455-M08).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KSR2 Antibody (H00283455-M08) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KSR2 Products
Research Areas for KSR2 Antibody (H00283455-M08)
Find related products by research area.
|
Blogs on KSR2