Independent Antibodies: Western Blot: UAF1/WDR48 Antibody [NBP1-81404] - Analysis using Anti-WDR48 antibody NBP1-81404 (A) shows similar pattern to independent antibody NBP2-49269 (B).
Immunocytochemistry/ Immunofluorescence: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human cervix, uterine shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human testis shows moderate to strong positivity.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
Simple Western: UAF1/WDR48 Antibody [NBP1-81404] - Simple Western lane view shows a specific band for UAF1/WDR48 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing ...read more
Simple Western: UAF1/WDR48 Antibody [NBP1-81404] - Electropherogram image(s) of corresponding Simple Western lane view. UAF1/WDR48 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).
Western Blot: UAF1/WDR48 Antibody [NBP1-81404] - EBNA3C associates with the WDR48/USP46 complex in EBNA3C-F-HA LCLs.Immunoprecipitation assay using Flag agarose to retrieve protein complexes from EBNA3C-F-HA LCLs ...read more
Western Blot: UAF1/WDR48 Antibody [NBP1-81404] - Deletion of EBNA3A residues 920–944 disrupts WDR48 binding without affecting CtBP1 association.Co-immunoprecipitation assay to assess binding of EBNA3A mutants to WDR48 ...read more
Western Blot: UAF1/WDR48 Antibody [NBP1-81404] - Identification of EBNA3A & EBNA3C domains that mediate WDR48 association.Immunoprecipitation assays to map WDR48 binding regions within EBNA3A (A) & EBNA3C (B). 293T ...read more
Western Blot: UAF1/WDR48 Antibody [NBP1-81404] - EBNA3 proteins preferentially bind the WDR48 subunit of the USP46 DUB complex.(A) Immunoprecipitation assay in 293T cells demonstrating association of flag tagged EBNA3 ...read more
Western Blot: UAF1/WDR48 Antibody [NBP1-81404] - WDR48 coimmunoprecipitates with RBPJ in EBV infected cells.Co-immunoprecipitation assays comparing the association of RBPJ with WDR48 in LCLs with that observed in EBV ...read more
Western Blot: UAF1/WDR48 Antibody [NBP1-81404] - ChIP assay for WDR48 at the p14ARF promoter.Chromatin immunoprecipitation (ChIP) assays were performed using antibodies for WDR48 (A) from EBNA3C-HT LCLs that were grown ...read more
Western Blot: UAF1/WDR48 Antibody [NBP1-81404] - WDR48 SLD2 mediates binding to EBNA3B & EBNA3C, but is not required for EBNA3A binding.Immunoprecipitation assays were performed to assess effect of deleting the WDR48 ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR48
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 87 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
76 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for UAF1/WDR48 Antibody - BSA Free
KIAA1449DKFZp686G1794
P80
UAF1
USP1 associated factor 1
USP1-associated factor 1
WD repeat domain 48
WD repeat endosomal protein
WD repeat-containing protein 48
WDR48
Background
Regulator of deubiquitinating complexes. Acts as a strong activator of USP1 by enhancing the USP1-mediateddeubiquitination of FANCD2; USP1 being almost inactive by itself. Also activates deubiquitinating activity ofcomplexes containing USP12 and USP46, respectively. Activates deubiquitination by increasing the catalytic turnoverwithout increasing the affinity of deubiquitinating enzymes for the substrate. In case of infection by Herpesvirussaimiri, may play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes.Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein(TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptorTCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP. In case of infection bypapillomavirus HPV11, promotes the maintenance of the viral genome via its interaction with HPV11 helicase E1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our UAF1/WDR48 Antibody - BSA Free and receive a gift card or discount.