UAF1/WDR48 Antibody

Images

 
Independent Antibodies: Western Blot: UAF1/WDR48 Antibody [NBP1-81404] - Analysis using Anti-WDR48 antibody NBP1-81404 (A) shows similar pattern to independent antibody NBP2-49269 (B).
Immunocytochemistry/ Immunofluorescence: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human cervix, uterine shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human testis shows moderate to strong positivity.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: UAF1/WDR48 Antibody [NBP1-81404] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
Simple Western: UAF1/WDR48 Antibody [NBP1-81404] - Simple Western lane view shows a specific band for UAF1/WDR48 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing ...read more
Simple Western: UAF1/WDR48 Antibody [NBP1-81404] - Electropherogram image(s) of corresponding Simple Western lane view. UAF1/WDR48 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

UAF1/WDR48 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
Specificity
Specificity of human UAF1/WDR48 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR48
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:20
  • Chromatin Immunoprecipitation
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Chip, IP, WB reactivity reported in (PMID: 25855980).
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
UAF1/WDR48 Protein (NBP1-81404PEP)
Publications
Read Publication using NBP1-81404.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25855980)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UAF1/WDR48 Antibody

  • KIAA1449DKFZp686G1794
  • P80
  • UAF1
  • USP1 associated factor 1
  • USP1-associated factor 1
  • WD repeat domain 48
  • WD repeat endosomal protein
  • WD repeat-containing protein 48
  • WDR48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
H00010963-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NB100-508
Species: Hu, Mu, Rt, Ha
Applications: WB, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB110-61646
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81404
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP

Publications for UAF1/WDR48 Antibody (NBP1-81404)(1)

We have publications tested in 3 applications: ChIP, IP, WB.


Filter By Application
ChIP
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for UAF1/WDR48 Antibody (NBP1-81404) (0)

There are no reviews for UAF1/WDR48 Antibody (NBP1-81404). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for UAF1/WDR48 Antibody (NBP1-81404) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UAF1/WDR48 Products

Bioinformatics Tool for UAF1/WDR48 Antibody (NBP1-81404)

Discover related pathways, diseases and genes to UAF1/WDR48 Antibody (NBP1-81404). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UAF1/WDR48 Antibody (NBP1-81404)

Discover more about diseases related to UAF1/WDR48 Antibody (NBP1-81404).
 

Pathways for UAF1/WDR48 Antibody (NBP1-81404)

View related products by pathway.

PTMs for UAF1/WDR48 Antibody (NBP1-81404)

Learn more about PTMs related to UAF1/WDR48 Antibody (NBP1-81404).

Blogs on UAF1/WDR48

There are no specific blogs for UAF1/WDR48, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UAF1/WDR48 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR48
Entrez
Uniprot