USP46 Antibody - BSA Free

Western Blot: USP46 Antibody [NBP1-82293] - Western blot for USP46 in 721 LCLs cells transfected with a plasmid expressing either of two guide RNAs targeting different USP46 exons (CRISPR 1 or CRISPR 2) and a hygromycin resistance gene. Prior to harvesting, cells were subjected to hygromycin selection for one month (resulting in 6 clones for CRISPR 1 and 8 clones CRISPR 2). Untransfected 721 cells are also shown (WT). As a loading control, lysates were probed for beta actin (bottom panel). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25855980/) licensed under a CC-BY license.

Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] -Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] - Staining of human Skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: USP46 Antibody [NBP1-82293] -Staining of human Liver shows very weak cytoplasmic positivity in hepatocytes.

ChIP assay for WDR48 at the p14ARF promoter.Chromatin immunoprecipitation (ChIP) assays were performed using antibodies for WDR48 (A) from EBNA3C-HT LCLs that were grown in the presence of 4HT (dark gray) or after 14 days of growth in the absence of 4HT (light gray). Amount of genomic DNA was measured by real time PCR using primers specific to the EBNA3C binding site in the p14ARF promoters or sites near the EIF2AK3 & PPIA genes which bind cell transcription factors but not EBNA3C. The bar graph represents the amount of DNA precipitated relative to the amount of DNA in the corresponding input sample. The experiment shown is representative of four independent experiments & error bars indicating standard error of the mean within this experiment. Asterisk denotes that the difference in ChIP signal seen at the p14ARF promoter is statistically significant (p = 0.01). (B) Western blot for USP46, WDR48, & tubulin levels in whole cell lysates from EBNA3CHT LCLs grown in the presence of 4HT or after 14 days of growth in the absence of 4HT. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.ppat.1004822), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: USP46 Antibody [NBP1-82293] - Purified EBNA3 complexes exhibit DUB activity.(A) Tandem affinity purification was performed on wild type or EBNA3-F-HA expressing LCLs. Purified complexes from wild type (X), E3A-F-HA (closed circle), E3B-F-HA (closed triangle), or E3C-F-HA (closed square) LCLs were assayed for DUB activity by fluorometric assay using Ub-AMC as a substrate. (B) Western blot of purified EBNA3 complexes used in (A) demonstrating selective precipitation of tagged EBNA3 protein complexes & co-purification of RBPJ & USP46 proteins. Lysates derived from the equivalent of approximately 1.5x106 cells (input), 2.4x106 cells (Flag elution), or 10x106 cells (HA elution) were loaded on each lane, separated by SDS PAGE, & probed with EBNA3s, Flag, EBNA3A, & HA antibodies. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.ppat.1004822), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USP46 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit USP46 Antibody - BSA Free (NBP1-82293) is a polyclonal antibody validated for use in IHC, WB, IP and ChIP. Anti-USP46 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN
• Predicted Species: Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP46
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) Reported in scientific literature (PMID: 25855980)
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation reported in scientific literature (PMID: 25855980)
  • Western Blot Reported in scientific literature (PMID: 25855980)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  USP46 Protein (NBP1-82293PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for USP46 Antibody - BSA Free

• Deubiquitinating enzyme 46
• EC 3.1.2.15
• EC 3.4.19.12
• FLJ11850
• FLJ12552
• FLJ14283
• FLJ39393
• ubiquitin carboxyl-terminal hydrolase 46
• ubiquitin specific peptidase 46
• ubiquitin specific protease 46
• ubiquitin thioesterase 46
• Ubiquitin thiolesterase 46
• Ubiquitin-specific-processing protease 46
• USP46

Background

Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinatedaction of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP46 belongs to a large family of cysteineproteases that function as deubiquitinating enzymes (Quesada et al., 2004 (PubMed 14715245)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for USP46 Antibody (NBP1-82293)(1)

Publication using NBP1-82293

• Ohashi M, Holthaus AM, Calderwood MA et al. The EBNA3 Family of Epstein-Barr Virus Nuclear Proteins Associates with the USP46/USP12 Deubiquitination Complexes to Regulate Lymphoblastoid Cell Line Growth. PLoS Pathog 2015-04-01 [PMID: 25855980] (IP, Chemotaxis, WB)

Bioinformatics

• Gene Symbol: USP46
• Entrez:
  • 64854(Human)
• Uniprot:
  • P62068()