USP1 Antibody

Images

 
Western Blot: USP1 Antibody [NBP2-55036] - Analysis using Anti-USP1 antibody NBP2-55036 (A) shows similar pattern to independent antibody NBP1-85950 (B).
Immunocytochemistry/ Immunofluorescence: USP1 Antibody [NBP2-55036] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HSGITISSGHYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNKKNVEAIGLLGGQKSKADYELYN
Specificity
Specificity of human USP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP1 Recombinant Protein Antigen (NBP2-55036PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for USP1 Antibody

  • Deubiquitinating Enzyme 1
  • EC 3.1.2.15
  • EC 3.4.19.12
  • hUBP
  • ubiquitin carboxyl terminal hydrolase 1
  • Ubiquitin Carboxyl-Terminal Hydrolase 1
  • ubiquitin specific peptidase 1
  • ubiquitin specific processing protease 1
  • ubiquitin specific protease 1
  • Ubiquitin Thioesterase 1
  • Ubiquitin thiolesterase 1
  • Ubiquitin-specific-processing protease 1
  • UBP
  • USP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NBP1-81404
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB600-1160
Species: Hu, Mu, Rt, Po, Bv, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NB600-893
Species: Hu, Pm-Or
Applications: WB, ELISA, ICC/IF
H00006449-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-02648
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NB100-57495
Species: Hu
Applications: WB, IP
E-504
Species: Hu
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for USP1 Antibody (NBP2-55036) (0)

There are no publications for USP1 Antibody (NBP2-55036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP1 Antibody (NBP2-55036) (0)

There are no reviews for USP1 Antibody (NBP2-55036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP1 Antibody (NBP2-55036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional USP1 Products

Bioinformatics Tool for USP1 Antibody (NBP2-55036)

Discover related pathways, diseases and genes to USP1 Antibody (NBP2-55036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP1 Antibody (NBP2-55036)

Discover more about diseases related to USP1 Antibody (NBP2-55036).
 

Pathways for USP1 Antibody (NBP2-55036)

View related products by pathway.

PTMs for USP1 Antibody (NBP2-55036)

Learn more about PTMs related to USP1 Antibody (NBP2-55036).

Blogs on USP1

There are no specific blogs for USP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP1