USP18 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit USP18 Antibody - BSA Free (NBP3-35697) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP18 (NP_059110.2).
Sequence: DVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
USP18 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 1:1000 - 1:5000
|
| Theoretical MW |
43 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for USP18 Antibody - BSA Free
Background
UBP43 (also known as ISG43, Ubl thiolesterase 18, ISG15-specific processing protease, 43 kDa ISG15-specific protease, ubiquitin specific protease 18 or USP18) is a member of the deubiquitinating protease family of enzymes, which removes ubiquitin adducts from a broad range of protein substrates. Deletion of the UBP43 gene in mouse leads to a massive increase of ISG15 conjugates in tissues indicating that UBP43 is a major ISG15-specific protease. UBP43 is the first ISG15-specific protease reported. Both ISG15 and UBP43 genes are known to be strongly induced by interferon, genotoxic stress, and viral infection. Thus UBP43 may be necessary to maintain a critical cellular balance of ISG15-conjugated proteins in both healthy and stressed organisms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Flow, Neut, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Publications for USP18 Antibody (NBP3-35697) (0)
There are no publications for USP18 Antibody (NBP3-35697).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for USP18 Antibody (NBP3-35697) (0)
There are no reviews for USP18 Antibody (NBP3-35697).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for USP18 Antibody (NBP3-35697) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional USP18 Products
Research Areas for USP18 Antibody (NBP3-35697)
Find related products by research area.
|
Blogs on USP18