UROD Antibody

Images

 
Western Blot: UROD Antibody [NBP1-89513] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: UROD Antibody [NBP1-89513] - Staining of human cell line U-2 OS shows positivity in cytoplasm and cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: UROD Antibody [NBP1-89513] - Staining of human kidney shows distinct cytoplasmic and nuclear positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UROD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UROD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UROD Protein (NBP1-89513PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UROD Antibody

  • EC 4.1.1.37
  • PCT
  • UPD
  • URO-D
  • uroporphyrinogen decarboxylase
  • uroporphyrinogen III decarboxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
H00002051-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
7570-GH
Species: Hu
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB763
Species: Hu, Mu, Rt
Applications: IHC
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UROD Antibody (NBP1-89513) (0)

There are no publications for UROD Antibody (NBP1-89513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UROD Antibody (NBP1-89513) (0)

There are no reviews for UROD Antibody (NBP1-89513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UROD Antibody (NBP1-89513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UROD Products

Bioinformatics Tool for UROD Antibody (NBP1-89513)

Discover related pathways, diseases and genes to UROD Antibody (NBP1-89513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UROD Antibody (NBP1-89513)

Discover more about diseases related to UROD Antibody (NBP1-89513).
 

Pathways for UROD Antibody (NBP1-89513)

View related products by pathway.

PTMs for UROD Antibody (NBP1-89513)

Learn more about PTMs related to UROD Antibody (NBP1-89513).
 

Research Areas for UROD Antibody (NBP1-89513)

Find related products by research area.

Blogs on UROD

There are no specific blogs for UROD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UROD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UROD