UROD Antibody


Western Blot: UROD Antibody [NBP1-89513] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: UROD Antibody [NBP1-89513] - Staining of human cell line U-2 OS shows positivity in cytoplasm and cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: UROD Antibody [NBP1-89513] - Staining of human kidney shows distinct cytoplasmic and nuclear positivity in tubule cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

UROD Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHF
Specificity of human UROD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UROD Protein (NBP1-89513PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for UROD Antibody

  • EC
  • PCT
  • UPD
  • URO-D
  • uroporphyrinogen decarboxylase
  • uroporphyrinogen III decarboxylase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Mu
Applications: WB
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UROD Antibody (NBP1-89513) (0)

There are no publications for UROD Antibody (NBP1-89513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UROD Antibody (NBP1-89513) (0)

There are no reviews for UROD Antibody (NBP1-89513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UROD Antibody (NBP1-89513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional UROD Products

Bioinformatics Tool for UROD Antibody (NBP1-89513)

Discover related pathways, diseases and genes to UROD Antibody (NBP1-89513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UROD Antibody (NBP1-89513)

Discover more about diseases related to UROD Antibody (NBP1-89513).

Pathways for UROD Antibody (NBP1-89513)

View related products by pathway.

PTMs for UROD Antibody (NBP1-89513)

Learn more about PTMs related to UROD Antibody (NBP1-89513).

Research Areas for UROD Antibody (NBP1-89513)

Find related products by research area.

Blogs on UROD

There are no specific blogs for UROD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our UROD Antibody and receive a gift card or discount.


Gene Symbol UROD