PPOX Antibody (2F10)

Images

 
Western Blot: PPOX Antibody (2F10) [H00005498-M01] - Analysis of PPOX expression in transfected 293T cell line by PPOX monoclonal antibody (M01), clone 2F10.Lane 1: PPOX transfected lysate(50.8 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: PPOX Antibody (2F10) [H00005498-M01] - Analysis of monoclonal antibody to PPOX on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. Antibody concentration 3 ug/ml.
Western Blot: PPOX Antibody (2F10) [H00005498-M01] - Analysis of PPOX over-expressed 293 cell line, cotransfected with PPOX Validated Chimera RNAi ( Cat # H00005498-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
ELISA: PPOX Antibody (2F10) [H00005498-M01] - Detection limit for recombinant GST tagged PPOX is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, KD
Clone
2F10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPOX Antibody (2F10) Summary

Immunogen
PPOX (AAH02357, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
Localization
Mitochondrial. Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
Specificity
PPOX - protoporphyrinogen oxidase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPOX
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, RNAi Validation and ELISA.
Publications
Read Publications using H00005498-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPOX Antibody (2F10)

  • EC 1.3.3.4
  • MGC8485
  • PPOVP
  • protoporphyrinogen oxidase
  • V290M
  • variegate porphyria

Background

This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80261
Applications: ELISA
AF009
Species: Hu
Applications: IHC, WB
NBP2-68928
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP1-54863
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IM, IP, KD, WB
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NBP2-33600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
9134-TN
Species: Hu
Applications: BA
H00005498-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, KD

Publications for PPOX Antibody (H00005498-M01)(3)

Reviews for PPOX Antibody (H00005498-M01) (0)

There are no reviews for PPOX Antibody (H00005498-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPOX Antibody (H00005498-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPOX Products

Bioinformatics Tool for PPOX Antibody (H00005498-M01)

Discover related pathways, diseases and genes to PPOX Antibody (H00005498-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPOX Antibody (H00005498-M01)

Discover more about diseases related to PPOX Antibody (H00005498-M01).
 

Pathways for PPOX Antibody (H00005498-M01)

View related products by pathway.

PTMs for PPOX Antibody (H00005498-M01)

Learn more about PTMs related to PPOX Antibody (H00005498-M01).
 

Research Areas for PPOX Antibody (H00005498-M01)

Find related products by research area.

Blogs on PPOX

There are no specific blogs for PPOX, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPOX Antibody (2F10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPOX
Entrez
OMIM
Uniprot