E6AP/UBE3A Antibody (2F6)

Images

 
Western Blot: E6AP/UBE3A Antibody (2F6) [H00007337-M01] - UBE3A monoclonal antibody (M01), clone 2F6. Analysis of UBE3A expression in PC-12.
Immunocytochemistry/ Immunofluorescence: E6AP/UBE3A Antibody (2F6) [H00007337-M01] - Analysis of monoclonal antibody to UBE3A on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: E6AP/UBE3A Antibody (2F6) [H00007337-M01] - Analysis of monoclonal antibody to UBE3A on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
Western Blot: E6AP/UBE3A Antibody (2F6) [H00007337-M01] - UBE3A expression in Jurkat ( Cat # L017V1 ).
ELISA: E6AP/UBE3A Antibody (2F6) [H00007337-M01] - Detection limit for recombinant GST tagged UBE3A is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

E6AP/UBE3A Antibody (2F6) Summary

Immunogen
UBE3A (AAH09271, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCR
Specificity
UBE3A - ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE3A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using
H00007337-M01 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for E6AP/UBE3A Antibody (2F6)

  • ANCR
  • ANCREPVE6AP
  • AS
  • CTCL tumor antigen se37-2
  • E6AP ubiquitin-protein ligase
  • E6AP
  • E6-AP
  • EC 6.3.2.-
  • EPVE6AP
  • FLJ26981
  • HPVE6A
  • human papilloma virus E6-associated protein
  • Human papillomavirus E6-associated protein
  • Oncogenic protein-associated protein E6-AP
  • Renal carcinoma antigen NY-REN-54
  • UBE3A
  • ubiquitin protein ligase E3A
  • ubiquitin-protein ligase E3A

Background

This gene encodes an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53. Alternative splicing of this gene results in three transcript variants encoding three isoforms with different N-termini. Additional transcript variants have been described, but their full length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
NB600-1101
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-199
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-32010
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-68142
Species: Hu
Applications: WB, Flow, PEP-ELISA, IF
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
H00007337-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for E6AP/UBE3A Antibody (H00007337-M01)(3)

Reviews for E6AP/UBE3A Antibody (H00007337-M01) (0)

There are no reviews for E6AP/UBE3A Antibody (H00007337-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for E6AP/UBE3A Antibody (H00007337-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional E6AP/UBE3A Products

Bioinformatics Tool for E6AP/UBE3A Antibody (H00007337-M01)

Discover related pathways, diseases and genes to E6AP/UBE3A Antibody (H00007337-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E6AP/UBE3A Antibody (H00007337-M01)

Discover more about diseases related to E6AP/UBE3A Antibody (H00007337-M01).
 

Pathways for E6AP/UBE3A Antibody (H00007337-M01)

View related products by pathway.

PTMs for E6AP/UBE3A Antibody (H00007337-M01)

Learn more about PTMs related to E6AP/UBE3A Antibody (H00007337-M01).
 

Research Areas for E6AP/UBE3A Antibody (H00007337-M01)

Find related products by research area.

Blogs on E6AP/UBE3A

There are no specific blogs for E6AP/UBE3A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our E6AP/UBE3A Antibody (2F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE3A
Entrez
OMIM
Uniprot