UNC45A Antibody

Images

 
Western Blot: UNC45A Antibody [NBP2-13506] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: UNC45A Antibody [NBP2-13506] - Staining of human cell line HEK 293 shows positivity in cytoplasm and golgi apparatus.
Immunohistochemistry-Paraffin: UNC45A Antibody [NBP2-13506] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UNC45A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAA ACLDKAVEYGLIQPNQDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UNC45A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UNC45A Protein (NBP2-13506PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UNC45A Antibody

  • FLJ10043
  • GCUNC45
  • GC-UNC45
  • GCUNC-45
  • general cell UNC45
  • protein unc-45 homolog A
  • SMAP-1IRO039700
  • SMAP1UNC-45A
  • smooth muscle cell associated protein-1
  • Smooth muscle cell-associated protein 1
  • unc-45 homolog A (C. elegans)
  • Unc-45A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-84426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
MAB5140
Species: Hu
Applications: IHC
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80737
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-32630
Species: Hu
Applications: IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-77563
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-83693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for UNC45A Antibody (NBP2-13506) (0)

There are no publications for UNC45A Antibody (NBP2-13506).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC45A Antibody (NBP2-13506) (0)

There are no reviews for UNC45A Antibody (NBP2-13506). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UNC45A Antibody (NBP2-13506) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UNC45A Products

Bioinformatics Tool for UNC45A Antibody (NBP2-13506)

Discover related pathways, diseases and genes to UNC45A Antibody (NBP2-13506). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC45A Antibody (NBP2-13506)

Discover more about diseases related to UNC45A Antibody (NBP2-13506).
 

Pathways for UNC45A Antibody (NBP2-13506)

View related products by pathway.

PTMs for UNC45A Antibody (NBP2-13506)

Learn more about PTMs related to UNC45A Antibody (NBP2-13506).

Blogs on UNC45A

There are no specific blogs for UNC45A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UNC45A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UNC45A