SMAP2 Antibody

Images

 
Western Blot: SMAP2 Antibody [NBP1-80737] - Analysis in human cell lines PC-3 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry-Paraffin: SMAP2 Antibody [NBP1-80737] - Staining of human lymph node shows strong positivity in cells outside the germinal center.
Western Blot: SMAP2 Antibody [NBP1-80737] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: SMAP2 Antibody [NBP1-80737] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Western Blot: SMAP2 Antibody [NBP1-80737] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQMWK
Specificity
Specificity of human, mouse, rat SMAP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
SMAP2 Protein (NBP1-80737PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMAP2 Antibody

  • RP1-228H13.3
  • small ArfGAP2
  • SMAP1L
  • SMOC2
  • stromal membrane-associated GTPase-activating protein 2
  • Stromal membrane-associated protein 1-like
  • stromal membrane-associated protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13506
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-49643
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KO
5140-SM
Species: Hu
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-81259
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00009685-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP1-88842
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-00513
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80737
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SMAP2 Antibody (NBP1-80737) (0)

There are no publications for SMAP2 Antibody (NBP1-80737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMAP2 Antibody (NBP1-80737) (0)

There are no reviews for SMAP2 Antibody (NBP1-80737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMAP2 Antibody (NBP1-80737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-80737

Bioinformatics Tool for SMAP2 Antibody (NBP1-80737)

Discover related pathways, diseases and genes to SMAP2 Antibody (NBP1-80737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMAP2 Antibody (NBP1-80737)

Discover more about diseases related to SMAP2 Antibody (NBP1-80737).
 

Pathways for SMAP2 Antibody (NBP1-80737)

View related products by pathway.

PTMs for SMAP2 Antibody (NBP1-80737)

Learn more about PTMs related to SMAP2 Antibody (NBP1-80737).

Blogs on SMAP2

There are no specific blogs for SMAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAP2