TTC12 Antibody

Western Blot: TTC12 Antibody [NBP1-83693] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: TTC12 Antibody [NBP1-83693] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: TTC12 Antibody [NBP1-83693] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TTC12 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLLETLSKPDQIPLFYAGGIEILTEMINECTEQTLFRMHNGFSIISDNEVIRRCFSTAGNDAVEEMVCVSVLKLWQAVCSRNEENQRVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TTC12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TTC12 Protein (NBP1-83693PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TTC12 Antibody

• FLJ13859
• FLJ20535
• tetratricopeptide repeat domain 12
• tetratricopeptide repeat protein 12 variant 1
• tetratricopeptide repeat protein 12 variant 2
• TPARMtetratricopeptide repeat protein 12
• TPR repeat protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TTC12