TTC12 Antibody

Images

 
Western Blot: TTC12 Antibody [NBP1-83693] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TTC12 Antibody [NBP1-83693] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TTC12 Antibody [NBP1-83693] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTC12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLLETLSKPDQIPLFYAGGIEILTEMINECTEQTLFRMHNGFSIISDNEVIRRCFSTAGNDAVEEMVCVSVLKLWQAVCSRNEENQRVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTC12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTC12 Protein (NBP1-83693PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC12 Antibody

  • FLJ13859
  • FLJ20535
  • tetratricopeptide repeat domain 12
  • tetratricopeptide repeat protein 12 variant 1
  • tetratricopeptide repeat protein 12 variant 2
  • TPARMtetratricopeptide repeat protein 12
  • TPR repeat protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86849
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5599
Species: Mu
Applications: WB, IHC
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3445
Species: Mu
Applications: WB, IHC
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-81150
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56458
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
AF756
Species: Mu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-83702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3315
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-47453
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TTC12 Antibody (NBP1-83693) (0)

There are no publications for TTC12 Antibody (NBP1-83693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC12 Antibody (NBP1-83693) (0)

There are no reviews for TTC12 Antibody (NBP1-83693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TTC12 Antibody (NBP1-83693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC12 Products

Bioinformatics Tool for TTC12 Antibody (NBP1-83693)

Discover related pathways, diseases and genes to TTC12 Antibody (NBP1-83693). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC12 Antibody (NBP1-83693)

Discover more about diseases related to TTC12 Antibody (NBP1-83693).
 

Pathways for TTC12 Antibody (NBP1-83693)

View related products by pathway.

PTMs for TTC12 Antibody (NBP1-83693)

Learn more about PTMs related to TTC12 Antibody (NBP1-83693).

Blogs on TTC12

There are no specific blogs for TTC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC12