ULBP-2 Antibody - Azide and BSA Free

Western Blot: ULBP-2 Antibody [H00080328-B01P] - Analysis of ULBP2 expression in human ovarian cancer.

Flow Cytometry: ULBP-2 Antibody [H00080328-B01P] - Analysis of negative control 293 cells (Black) and ULBP2 expressing 293 cells (Green) using ULBP2 purified mouse polyclonal antibody.

Western Blot: ULBP-2 Antibody [H00080328-B01P] - Analysis of ULBP2 expression in transfected 293T cell line by ULBP2 polyclonal antibody. Lane 1: ULBP2 transfected lysate(27.17 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, Flow, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ULBP-2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ULBP-2 Antibody - Azide and BSA Free (H00080328-B01P) is a polyclonal antibody validated for use in WB, Flow and ICC/IF. Anti-ULBP-2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ULBP2 (AAH34689, 1 a.a. - 246 a.a.) full-length human protein. MEAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI
• Specificity: ULBP2 - UL16 binding protein 2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ULBP2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA and FACS analysis. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 26046815)

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ULBP-2 Antibody - Azide and BSA Free

• ALCAN-alpha
• N2DL2
• N2DL-2
• NKG2D ligand 2
• NKG2DL2
• RAET1H
• RAET1HNKG2DL2
• retinoic acid early transcript 1 H
• Retinoic acid early transcript 1H
• UL16 binding protein 2
• UL16-binding protein 2
• ULBP2
• ULBP-2

Background

Ligand for the NKG2D receptor, together with at least ULBP1 and ULBP3. ULBPs activate multiple signalingpathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands toNKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transductionpathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked theinteraction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system.UL16 also causes ULBP2 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ULBP-2 Antibody (H00080328-B01P)(1)

Publication using H00080328-B01P

• Katlinskaya YV, Carbone CJ, Yu Q, Fuchs SY. Type 1 interferons contribute to the clearance of senescent cell Cancer Biol. Ther. 2015-06-05 [PMID: 26046815] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: ULBP2
• Entrez:
  • 80328(Human)
• Uniprot:
  • AAH34689(Human)