Recombinant Human UGCG Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UGCG Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 33-131 of Human UGCG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
UGCG
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UGCG Protein

  • ceramide glucosyltransferase
  • EC 2.4.1.80
  • GCSGLCT1
  • GLCT-1
  • Glucosylceramide synthase
  • UDP-glucose ceramide glucosyltransferaseUDP-glucose:N-acylsphingosine D-glucosyltransferase

Background

UGCG - UDP-glucose ceramide glucosyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-46466
Species: Hu
Applications: IHC
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-45889
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-03351
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00007357-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for UGCG Partial Recombinant Protein (H00007357-Q01) (0)

There are no publications for UGCG Partial Recombinant Protein (H00007357-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGCG Partial Recombinant Protein (H00007357-Q01) (0)

There are no reviews for UGCG Partial Recombinant Protein (H00007357-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGCG Partial Recombinant Protein (H00007357-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UGCG Products

Bioinformatics Tool for UGCG Partial Recombinant Protein (H00007357-Q01)

Discover related pathways, diseases and genes to UGCG Partial Recombinant Protein (H00007357-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGCG Partial Recombinant Protein (H00007357-Q01)

Discover more about diseases related to UGCG Partial Recombinant Protein (H00007357-Q01).
 

Pathways for UGCG Partial Recombinant Protein (H00007357-Q01)

View related products by pathway.

PTMs for UGCG Partial Recombinant Protein (H00007357-Q01)

Learn more about PTMs related to UGCG Partial Recombinant Protein (H00007357-Q01).

Blogs on UGCG

There are no specific blogs for UGCG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UGCG Antibody (1E5.)
H00007357-M03
GM-CSF [Unconjugated]
215-GM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UGCG Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UGCG