UCP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UCP4 Antibody [NBP2-57763] - Staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UCP4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFL
Specificity
Specificity of human UCP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A27
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UCP4 Recombinant Protein Antigen (NBP2-57763PEP)

Reactivity Notes

Mouse 89%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UCP4 Antibody

  • FLJ33552
  • mitochondrial uncoupling protein 4
  • Solute carrier family 25 member 27
  • solute carrier family 25, member 27
  • UCP 4
  • UCP4uncoupling protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59598
Species: Hu
Applications: WB
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-50179
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC-P, IP, In vitro
NBP1-82626
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, KO
NBP1-87436
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-57763
Species: Hu
Applications: ICC/IF

Publications for UCP4 Antibody (NBP2-57763) (0)

There are no publications for UCP4 Antibody (NBP2-57763).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP4 Antibody (NBP2-57763) (0)

There are no reviews for UCP4 Antibody (NBP2-57763). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UCP4 Antibody (NBP2-57763) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for UCP4 Antibody (NBP2-57763)

Discover related pathways, diseases and genes to UCP4 Antibody (NBP2-57763). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCP4 Antibody (NBP2-57763)

Discover more about diseases related to UCP4 Antibody (NBP2-57763).
 

Pathways for UCP4 Antibody (NBP2-57763)

View related products by pathway.

PTMs for UCP4 Antibody (NBP2-57763)

Learn more about PTMs related to UCP4 Antibody (NBP2-57763).

Blogs on UCP4

There are no specific blogs for UCP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A27