UCP3 Antibody

Images

 
Western Blot: UCP3 Antibody [NBP2-88547] - Host: Rabbit. Target Name: UCP3. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UCP3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UCP3. Peptide sequence: CTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
UCP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UCP3 Antibody

  • mitochondrial uncoupling protein 3
  • SLC25A9Solute carrier family 25 member 9
  • UCP 3
  • uncoupling protein 3 (mitochondrial, proton carrier)
  • Uncoupling protein-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59742
Species: Hu, Mu, Rt
Applications: ICC/IF, PEP-ELISA, WB
MAB6158
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DLP00
Species: Hu
Applications: ELISA
NBP2-92503
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-59598
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94703
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB400-144
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-2564
Species: Hu
Applications: WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP2-88547
Species: Hu
Applications: WB

Publications for UCP3 Antibody (NBP2-88547) (0)

There are no publications for UCP3 Antibody (NBP2-88547).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP3 Antibody (NBP2-88547) (0)

There are no reviews for UCP3 Antibody (NBP2-88547). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCP3 Antibody (NBP2-88547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UCP3 Products

Bioinformatics Tool for UCP3 Antibody (NBP2-88547)

Discover related pathways, diseases and genes to UCP3 Antibody (NBP2-88547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCP3 Antibody (NBP2-88547)

Discover more about diseases related to UCP3 Antibody (NBP2-88547).
 

Pathways for UCP3 Antibody (NBP2-88547)

View related products by pathway.

PTMs for UCP3 Antibody (NBP2-88547)

Learn more about PTMs related to UCP3 Antibody (NBP2-88547).
 

Research Areas for UCP3 Antibody (NBP2-88547)

Find related products by research area.

Blogs on UCP3

There are no specific blogs for UCP3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UCP3