Recombinant Human UCP1 Protein

Images

 
SDS-Page: Recombinant Human UCP1 Protein [H00007350-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human UCP1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 232-267 of Human UCP1

Source: Wheat Germ

Amino Acid Sequence: PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
UCP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
29.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UCP1 Protein

  • SLC25A7
  • SLC25A7mitochondrial brown fat uncoupling protein 1
  • Solute carrier family 25 member 7
  • Thermogenin
  • UCP 1
  • UCP
  • UCP1
  • uncoupling protein 1 (mitochondrial, proton carrier)

Background

UCP1 - uncoupling protein 1 (mitochondrial, proton carrier)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-59598
Species: Hu
Applications: WB
NBP2-57763
Species: Hu
Applications: ICC/IF
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
H00060386-P01
Species: Hu
NBP1-36987
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00007350-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for UCP1 Partial Recombinant Protein (H00007350-Q01) (0)

There are no publications for UCP1 Partial Recombinant Protein (H00007350-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCP1 Partial Recombinant Protein (H00007350-Q01) (0)

There are no reviews for UCP1 Partial Recombinant Protein (H00007350-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UCP1 Partial Recombinant Protein (H00007350-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UCP1 Products

Bioinformatics Tool for UCP1 Partial Recombinant Protein (H00007350-Q01)

Discover related pathways, diseases and genes to UCP1 Partial Recombinant Protein (H00007350-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCP1 Partial Recombinant Protein (H00007350-Q01)

Discover more about diseases related to UCP1 Partial Recombinant Protein (H00007350-Q01).
 

Pathways for UCP1 Partial Recombinant Protein (H00007350-Q01)

View related products by pathway.

PTMs for UCP1 Partial Recombinant Protein (H00007350-Q01)

Learn more about PTMs related to UCP1 Partial Recombinant Protein (H00007350-Q01).

Blogs on UCP1

There are no specific blogs for UCP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UCP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UCP1
Entrez