SLC25A19 Antibody

Images

 
Western Blot: SLC25A19 Antibody [NBP2-94007] - Analysis of extracts of HT-29 cells, using SLC25A19 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per ...read more
Immunocytochemistry/ Immunofluorescence: SLC25A19 Antibody [NBP2-94007] - Analysis of NIH/3T3 cells using SLC25A19 at dilution of 1:100. Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A19 Antibody Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SLC25A19 (NP_068380.3). MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A19
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLC25A19 Antibody

  • DNC
  • MCPHA
  • mitochondrial thiamine pyrophosphate carrier
  • mitochondrial uncoupling protein 1
  • MUP1
  • solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19
  • solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19
  • TPC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
MAB6158
Species: Hu, Mu
Applications: ICC, ICFlow, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-92503
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-30670
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-98661
Species: Hu
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-83642
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DKK300
Species: Hu
Applications: ELISA
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-94007
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for SLC25A19 Antibody (NBP2-94007) (0)

There are no publications for SLC25A19 Antibody (NBP2-94007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A19 Antibody (NBP2-94007) (0)

There are no reviews for SLC25A19 Antibody (NBP2-94007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC25A19 Antibody (NBP2-94007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A19 Products

Bioinformatics Tool for SLC25A19 Antibody (NBP2-94007)

Discover related pathways, diseases and genes to SLC25A19 Antibody (NBP2-94007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A19 Antibody (NBP2-94007)

Discover more about diseases related to SLC25A19 Antibody (NBP2-94007).
 

Pathways for SLC25A19 Antibody (NBP2-94007)

View related products by pathway.

PTMs for SLC25A19 Antibody (NBP2-94007)

Learn more about PTMs related to SLC25A19 Antibody (NBP2-94007).

Blogs on SLC25A19

There are no specific blogs for SLC25A19, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A19