UCH-L1/PGP9.5 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

UCH-L1/PGP9.5 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UCHL1.
  
  

  Source: E. coli

  Amino Acid Sequence: QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: UCHL1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46621.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UCH-L1/PGP9.5 Recombinant Protein Antigen

• EC 3.4.19.12
• EC 6.-
• Neuron cytoplasmic protein 9.5
• PARK5
• PGP 9.5
• PGP9.5
• PGP9.5Uch-L1
• PGP95
• ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
• ubiquitin carboxyl-terminal hydrolase isozyme L1
• ubiquitin C-terminal hydrolase
• Ubiquitin thioesterase L1
• UCHL1
• UCH-L1

Background

Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) is a soluble cytoplasmic protein found in neurons and in cells of the diffuse neuroendocrine system, and their respective tumors. Therefore, UCH-L1 has been widely used as a peripheral nerve fiber marker. UCHL-1 functions as a tissue-specific ubiquitin carboxyl terminal hydrolase isoenzyme involved in the processing of both ubiquitin precursors and ubiquitinated proteins.

UCH L1 is down-regulated in brains from Parkinson disease and Alzheimer disease patients, and certian site specific mutations in the UCHL1 gene can either increase or decrese the risk of Parkinson's and/or Alzheimer's neurodegenerative diseases.

Human UCHL 1 and the closely related UCHL3 protein have one of the most complicated knot structures ever discovered, with five knot crossings. This knot structure is expected to help the protein resist degradation in the proteasome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: UCHL1