UCH-L1/PGP9.5 Recombinant Protein Antigen

Images

 
There are currently no images for UCH-L1/PGP9.5 Recombinant Protein Antigen (NBP1-87334PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UCH-L1/PGP9.5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UCHL1.

Source: E. coli

Amino Acid Sequence: QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UCHL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87334.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UCH-L1/PGP9.5 Recombinant Protein Antigen

  • EC 3.4.19.12
  • EC 6.-
  • Neuron cytoplasmic protein 9.5
  • PARK5
  • PGP 9.5
  • PGP9.5
  • PGP9.5Uch-L1
  • PGP95
  • ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
  • ubiquitin carboxyl-terminal hydrolase isozyme L1
  • ubiquitin C-terminal hydrolase
  • Ubiquitin thioesterase L1
  • UCHL1
  • UCH-L1

Background

Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) is a soluble cytoplasmic protein found in neurons and in cells of the diffuse neuroendocrine system, and their respective tumors. Therefore, UCH-L1 has been widely used as a peripheral nerve fiber marker. UCHL-1 functions as a tissue-specific ubiquitin carboxyl terminal hydrolase isoenzyme involved in the processing of both ubiquitin precursors and ubiquitinated proteins.

UCH L1 is down-regulated in brains from Parkinson disease and Alzheimer disease patients, and certian site specific mutations in the UCHL1 gene can either increase or decrese the risk of Parkinson's and/or Alzheimer's neurodegenerative diseases.

Human UCHL 1 and the closely related UCHL3 protein have one of the most complicated knot structures ever discovered, with five knot crossings. This knot structure is expected to help the protein resist degradation in the proteasome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86037
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-46349
Species: Hu
Applications: IHC,  IHC-P, WB
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB300-270
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, In vitro, Simple Western, WB
NBP1-87334PEP
Species: Hu
Applications: AC

Publications for UCH-L1/PGP9.5 Recombinant Protein Antigen (NBP1-87334PEP) (0)

There are no publications for UCH-L1/PGP9.5 Recombinant Protein Antigen (NBP1-87334PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCH-L1/PGP9.5 Recombinant Protein Antigen (NBP1-87334PEP) (0)

There are no reviews for UCH-L1/PGP9.5 Recombinant Protein Antigen (NBP1-87334PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UCH-L1/PGP9.5 Recombinant Protein Antigen (NBP1-87334PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UCH-L1/PGP9.5 Products

Research Areas for UCH-L1/PGP9.5 Recombinant Protein Antigen (NBP1-87334PEP)

Find related products by research area.

Blogs on UCH-L1/PGP9.5

There are no specific blogs for UCH-L1/PGP9.5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UCH-L1/PGP9.5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UCHL1