UBL4A Antibody

Images

 
Western Blot: UBL4A Antibody [NBP1-84956] - Analysis in human cell line U-251 MG.
Immunohistochemistry-Paraffin: UBL4A Antibody [NBP1-84956] - Staining of human cerebellum shows cytoplasmic positivity in purkinje cells.
Western Blot: UBL4A Antibody [NBP1-84956] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBL4A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBL4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
UBL4A Protein (NBP1-84956PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBL4A Antibody

  • DXS254EUbiquitin-like protein GDX
  • G6PD
  • GDXubiquitin-like 4
  • GET5
  • MDY2
  • TMA24
  • ubiquitin-like 4A
  • ubiquitin-like protein 4A
  • UBL4DX254E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90367
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for UBL4A Antibody (NBP1-84956) (0)

There are no publications for UBL4A Antibody (NBP1-84956).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBL4A Antibody (NBP1-84956) (0)

There are no reviews for UBL4A Antibody (NBP1-84956). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBL4A Antibody (NBP1-84956) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBL4A Products

Bioinformatics Tool for UBL4A Antibody (NBP1-84956)

Discover related pathways, diseases and genes to UBL4A Antibody (NBP1-84956). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBL4A Antibody (NBP1-84956)

Discover more about diseases related to UBL4A Antibody (NBP1-84956).
 

Pathways for UBL4A Antibody (NBP1-84956)

View related products by pathway.

Blogs on UBL4A

There are no specific blogs for UBL4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBL4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBL4A