Ubiquitin Antibody

Product Discontinued

Ubiquitin Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: RPS27A (NP_002945.1, 1 a.a. - 156 a.a.) full-length human protein. MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
• Specificity: RPS27A - ribosomal protein S27a,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPS27A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate for WB and recombinant protein with GST tag for ELISA and WB. GST tag alone is used as a negative control. IHC usage reported in scientific literature (PMID: 24833360).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ubiquitin Antibody

• RPS27A
• UBA52
• UBB ubiquitin B
• UBB
• UBC
• Ubiquitin

Background

Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.[provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ubiquitin Antibody (H00006233-D01P)(1)

Publication using H00006233-D01P

• Gunasekaran VP, Ganeshan M. Inverse correlation of ribosomal protein S27A and multifunctional protein YB-1 in hepatocellular carcinoma. Clin Biochem. 2014-05-14 [PMID: 24833360] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: RPS27A
• Uniprot:
  • NP_002945.1(Human)