Ubiquilin 2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Ubiquilin 2 Antibody [NBP1-85639] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Ubiquilin 2 Antibody [NBP1-85639] - Staining of human cerebellum shows moderate to strong cytoplasmic and nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Ubiquilin 2 Antibody [NBP1-85639] - Staining of human fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Ubiquilin 2 Antibody [NBP1-85639] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons and glial cells.

Immunohistochemistry-Paraffin: Ubiquilin 2 Antibody [NBP1-85639] - Staining of human placenta shows moderate to strong cytoplasmic positivity in cytotrophoblast.

Simple Western: Ubiquilin 2 Antibody [NBP1-85639] - Simple Western lane view shows a specific band for Ubiquilin 2 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Ubiquilin 2 Antibody [NBP1-85639] - Electropherogram image(s) of corresponding Simple Western lane view. Ubiquilin 2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Analysis in human cell line A-431.

• Reactivity: Hu, Mu
• Applications: WB, Simple Western, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ubiquilin 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ubiquilin 2 Antibody - BSA Free (NBP1-85639) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-Ubiquilin 2 Antibody: Cited in 7 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UBQLN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF reported in the literature (PMID:26152284). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 72 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  Ubiquilin 2 Protein (NBP1-85639PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%). Mouse reactivity reported in scientific literature (PMID: 26141599), (PMID: 26152284).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ubiquilin 2 Antibody - BSA Free

• Chap1
• CHAP1/DSK2
• DSK2 homolog
• DSK2
• FLJ10167
• FLJ56541
• hPLIC-2
• N4BP4LIC-2
• Nedd4 binding protein 4
• PLIC-2
• PLIC2Dsk2
• Protein linking IAP with cytoskeleton 2
• RIHFB2157
• ubiquilin 2
• ubiquilin-2
• Ubiquitin-like product Chap1/Dsk2

Background

Ubiquilin 2 encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ubiquilin 2 Antibody (NBP1-85639)(7)

Publications using NBP1-85639

• Idera, A;Sharkey, LM;Kurauchi, Y;Kadoyama, K;Paulson, HL;Katsuki, H;Seki, T; Wild-type and pathogenic forms of ubiquilin 2 differentially modulate components of the autophagy-lysosome pathways Journal of pharmacological sciences 2023-07-01 [PMID: 37257946] (Western Blot, Human)
• Sharkey LM, Sandoval-Pistorius SS, Moore SJ et al. Modeling UBQLN2-mediated neurodegenerative disease in mice: Shared and divergent properties of wild type and mutant UBQLN2 in phase separation, subcellular localization, altered proteostasis pathways, and selective cytotoxicity Neurobiol. Dis. 2020-07-10 [PMID: 32653673] (WB, ICC/IF, Mouse)
• Sharkey LM, Safren N, Pithadia AS et al. Mutant UBQLN2 promotes toxicity by modulating intrinsic self-assembly. Proc. Natl. Acad. Sci. U.S.A. 2018-10-30 [PMID: 30333186] (WB, ICC/IF, Mouse)
• Yau RG, Doerner K, Castellanos ER et al. Assembly and Function of Heterotypic Ubiquitin Chains in Cell-Cycle and Protein Quality Control. Cell. 2017-10-11 [PMID: 29033132] (WB)
• Ceballos-Diaz C, Rosario AM, Park HJ et al. Viral expression of ALS-linked ubiquilin-2 mutants causes inclusion pathology and behavioral deficits in mice. Mol Neurodegener 2015-07-08 [PMID: 26152284] (ICC/IF, Mouse)
• Zeng L, Wang B, Merillat SA et al. Differential recruitment of UBQLN2 to nuclear inclusions in the polyglutamine diseases HD and SCA3 Neurobiol. Dis. 2015-06-30 [PMID: 26141599] (IHC-P, WB, Human, Mouse)
• Bieniek KF, Murray ME, Rutherford NJ et al. Tau pathology in frontotemporal lobar degeneration with C9ORF72 hexanucleotide repeat expansion. Acta Neuropathol. 2012-09-28 [PMID: 23053135] (IF/IHC, ICC/IF, Human)

Bioinformatics

• Gene Symbol: UBQLN2