STCH Antibody

Images

 
Western Blot: STCH Antibody [NBP1-80715] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: STCH Antibody [NBP1-80715] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: STCH Antibody [NBP1-80715] - Staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.
Immunohistochemistry-Paraffin: STCH Antibody [NBP1-80715] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: STCH Antibody [NBP1-80715] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: STCH Antibody [NBP1-80715] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts and leydig cell.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STCH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSPA13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STCH Protein (NBP1-80715PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STCH Antibody

  • heat shock 70 kDa protein 13
  • heat shock protein 70kDa family, member 13
  • microsomal stress 70 protein ATPase core
  • Microsomal stress-70 protein ATPase core
  • STCHStress-70 protein chaperone microsome-associated 60 kDa protein
  • stress 70 protein chaperone, microsome-associated, 60kD
  • stress 70 protein chaperone, microsome-associated, 60kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00029978-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13674
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94330
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85768
Species: Hu
Applications: IHC, IHC-P
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB120-3341
Species: ChHa, Ha, Hu, Mu
Applications: WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
AF6438
Species: Hu, Mu, Rt
Applications: ICC, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP2-27398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
7707-NP
Species: Hu
Applications: BA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB400-129
Species: Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-97503
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87969
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for STCH Antibody (NBP1-80715) (0)

There are no publications for STCH Antibody (NBP1-80715).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STCH Antibody (NBP1-80715) (0)

There are no reviews for STCH Antibody (NBP1-80715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STCH Antibody (NBP1-80715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STCH Products

Bioinformatics Tool for STCH Antibody (NBP1-80715)

Discover related pathways, diseases and genes to STCH Antibody (NBP1-80715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STCH Antibody (NBP1-80715)

Discover more about diseases related to STCH Antibody (NBP1-80715).

Research Areas for STCH Antibody (NBP1-80715)

Find related products by research area.

Blogs on STCH

There are no specific blogs for STCH, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STCH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA13
Entrez
Uniprot