Ubiquilin 1 Antibody

Images

 
Western Blot: Ubiquilin 1 Antibody [NBP1-56536] - 293T tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: Ubiquilin 1 Antibody [NBP1-56536] - Human Lung, respiratory epethelium, 5.0ug/ml.
Immunohistochemistry-Paraffin: Ubiquilin 1 Antibody [NBP1-56536] - Human Lung.
Immunohistochemistry-Paraffin: Ubiquilin 1 Antibody [NBP1-56536] - Human Lung.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Ubiquilin 1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to UBQLN1(ubiquilin 1) The peptide sequence was selected from the middle region of UBQLN1. Peptide sequence QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBQLN1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-56536 in the following applications:

  • IHC
    1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Ubiquilin 1 Antibody

  • DA41
  • DA41FLJ90054
  • DSK2
  • hPLIC-1
  • PLIC1
  • PLIC-1
  • PLIC-1UBQN
  • Protein linking IAP with cytoskeleton 1
  • Ubiquilin 1
  • ubiquilin-1
  • UBQLN1
  • UBQN
  • XDRP1

Background

UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and it is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene.This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00029978-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
NBP2-31106
Species: Hu, Mu
Applications: CyTOF-ready, Flow-CS, Flow, ICC, ICC/IF, IHC, IHC-P, IP, WB
NBP2-52549
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-1483
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, PEP-ELISA, PLA, WB
NBP1-31417
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01294
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB
AF755
Species: Mu
Applications: Block, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
NBP1-56536
Species: Hu
Applications: WB, IHC

Publications for Ubiquilin 1 Antibody (NBP1-56536)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-56536 Applications Species
Wang Y, Ouyang S, Liu M et al Humoral immune response to tumor-associated antigen Ubiquilin 1 (UBQLN1) and its tumor-promoting potential in lung cancer Research Square 2022-11-08 (IHC, WB, Human)

Details:
WB Dilutions: 1:5000; IHC Dilutions: 1:100
IHC, WB Human
Mohan HM, Trzeciakiewicz H, Pithadia A et al. RTL8 promotes nuclear localization of UBQLN2 to subnuclear compartments associated with protein quality control Cellular and molecular life sciences : CMLS 2022-03-05 [PMID: 35247097] (WB, Human) WB Human

Reviews for Ubiquilin 1 Antibody (NBP1-56536) (0)

There are no reviews for Ubiquilin 1 Antibody (NBP1-56536). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ubiquilin 1 Antibody (NBP1-56536). (Showing 1 - 1 of 1 FAQs).

  1. Is there presence of mycobacteria in this immunogenic injection?
    • We do not know if there is mycobacteria in our immunogenic injections, as we have never tested for it. That does not mean it is not present, it just means that we have never had any reason to test for its presence or absence

Secondary Antibodies

 

Isotype Controls

Additional Ubiquilin 1 Products

Bioinformatics Tool for Ubiquilin 1 Antibody (NBP1-56536)

Discover related pathways, diseases and genes to Ubiquilin 1 Antibody (NBP1-56536). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ubiquilin 1 Antibody (NBP1-56536)

Discover more about diseases related to Ubiquilin 1 Antibody (NBP1-56536).
 

Pathways for Ubiquilin 1 Antibody (NBP1-56536)

View related products by pathway.

PTMs for Ubiquilin 1 Antibody (NBP1-56536)

Learn more about PTMs related to Ubiquilin 1 Antibody (NBP1-56536).

Blogs on Ubiquilin 1

There are no specific blogs for Ubiquilin 1, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ubiquilin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBQLN1
Uniprot