Ubiquilin 1 Antibody


Western Blot: Ubiquilin 1 Antibody [NBP1-56536] - 293T tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: Ubiquilin 1 Antibody [NBP1-56536] - Human Lung, respiratory epethelium, 5.0ug/ml.
Immunohistochemistry-Paraffin: Ubiquilin 1 Antibody [NBP1-56536] - Human Lung.
Immunohistochemistry-Paraffin: Ubiquilin 1 Antibody [NBP1-56536] - Human Lung.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Ubiquilin 1 Antibody Summary

Synthetic peptides corresponding to UBQLN1(ubiquilin 1) The peptide sequence was selected from the middle region of UBQLN1. Peptide sequence QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against UBQLN1 and was validated on Western blot.
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ubiquilin 1 Antibody

  • DA41
  • DA41FLJ90054
  • DSK2
  • hPLIC-1
  • PLIC1
  • PLIC-1
  • Protein linking IAP with cytoskeleton 1
  • Ubiquilin 1
  • ubiquilin-1
  • UBQLN1
  • UBQN
  • XDRP1


UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and it is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene.This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Block
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ubiquilin 1 Antibody (NBP1-56536) (0)

There are no publications for Ubiquilin 1 Antibody (NBP1-56536).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ubiquilin 1 Antibody (NBP1-56536) (0)

There are no reviews for Ubiquilin 1 Antibody (NBP1-56536). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ubiquilin 1 Antibody (NBP1-56536). (Showing 1 - 1 of 1 FAQ).

  1. Is there presence of mycobacteria in this immunogenic injection?
    • We do not know if there is mycobacteria in our immunogenic injections, as we have never tested for it. That does not mean it is not present, it just means that we have never had any reason to test for its presence or absence

Secondary Antibodies


Isotype Controls

Additional Ubiquilin 1 Products

Bioinformatics Tool for Ubiquilin 1 Antibody (NBP1-56536)

Discover related pathways, diseases and genes to Ubiquilin 1 Antibody (NBP1-56536). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ubiquilin 1 Antibody (NBP1-56536)

Discover more about diseases related to Ubiquilin 1 Antibody (NBP1-56536).

Pathways for Ubiquilin 1 Antibody (NBP1-56536)

View related products by pathway.

PTMs for Ubiquilin 1 Antibody (NBP1-56536)

Learn more about PTMs related to Ubiquilin 1 Antibody (NBP1-56536).

Blogs on Ubiquilin 1

There are no specific blogs for Ubiquilin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ubiquilin 1 Antibody and receive a gift card or discount.


Gene Symbol UBQLN1