UBE2M/Ubc12 Antibody

Images

 
Independent Antibodies: Western Blot: UBE2M/Ubc12 Antibody [NBP2-49137] - Analysis using Anti-UBE2M antibody NBP2-49137 (A) shows similar pattern to independent antibody NBP2-49268 (B).
Immunocytochemistry/ Immunofluorescence: UBE2M/Ubc12 Antibody [NBP2-49137] - Analysis of human cell line HEK 293 shows positivity in nucleus & cytoplasm.
Immunohistochemistry-Paraffin: UBE2M/Ubc12 Antibody [NBP2-49137] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

UBE2M/Ubc12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Specificity
Specificity of human UBE2M/Ubc12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2M
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UBE2M/Ubc12 Recombinant Protein Antigen (NBP2-49137PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBE2M/Ubc12 Antibody

  • EC 6.3.2
  • EC 6.3.2.-
  • hUbc12
  • NEDD8 carrier protein
  • NEDD8 protein ligase
  • UBC12
  • UBC12NEDD8-conjugating enzyme Ubc12
  • UbcH12
  • UBC-RS2
  • UBE2M
  • ubiquitin carrier protein M
  • Ubiquitin-conjugating enzyme E2 M
  • ubiquitin-conjugating enzyme E2M (homologous to yeast UBC12)
  • ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
  • ubiquitin-protein ligase M
  • yeast UBC12 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UL-812
Species: Hu
NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-75926
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-75643
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-61712
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
H00054165-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-75459
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49137
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UBE2M/Ubc12 Antibody (NBP2-49137) (0)

There are no publications for UBE2M/Ubc12 Antibody (NBP2-49137).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2M/Ubc12 Antibody (NBP2-49137) (0)

There are no reviews for UBE2M/Ubc12 Antibody (NBP2-49137). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBE2M/Ubc12 Antibody (NBP2-49137) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UBE2M/Ubc12 Products

Bioinformatics Tool for UBE2M/Ubc12 Antibody (NBP2-49137)

Discover related pathways, diseases and genes to UBE2M/Ubc12 Antibody (NBP2-49137). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2M/Ubc12 Antibody (NBP2-49137)

Discover more about diseases related to UBE2M/Ubc12 Antibody (NBP2-49137).
 

Pathways for UBE2M/Ubc12 Antibody (NBP2-49137)

View related products by pathway.

Blogs on UBE2M/Ubc12

There are no specific blogs for UBE2M/Ubc12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2M/Ubc12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2M