APPBP1 Antibody

Western Blot: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Analysis using Anti-NAE1 antibody NBP1-92162 (A) shows similar pattern to independent antibody NBP1-92163 (B).

Immunohistochemistry-Paraffin: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Western Blot: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Staining of human cerebral cortex, colon, prostate and testis using Anti-NAE1 antibody NBP1-92162 (A) shows similar protein distribution across tissues to independent antibody NBP1-92163 (B).

Immunohistochemistry-Paraffin: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Staining of human prostate shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

APPBP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant APPBP1 Protein corresponding to amino acids: PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAE1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin: HIER pH6 retrieval method is recommended.
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  NEDD8 Activating Enzyme (APPBP1/UBA3) Protein (NBP1-92162PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for APPBP1 Antibody

• A-116A10.1
• amyloid beta precursor protein binding protein 1, 59kDa
• Amyloid beta precursor protein-binding protein 1, 59 kDa
• amyloid beta precursor protein-binding protein 1, 59kD
• APPBP1
• APP-BP1
• HPP1
• NAE1
• NEDD8 activating enzyme E1 subunit 1
• NEDD8-activating enzyme E1 regulatory subunit
• NEDD8-activating enzyme E1 subunit
• protooncogene protein 1
• Proto-oncogene protein 1
• ula-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162)(1)

Publication using NBP1-92162

• Park HS, Ju UI, Park JW et al. PPARgamma neddylation essential for adipogenesis is a potential target for treating obesity Cell Death Differ. 2016-03-18 [PMID: 26990658] (WB, Mouse)

Bioinformatics

• Gene Symbol: NAE1
• Entrez:
  • 8883(Human)
• Uniprot:
  • Q13564(Human)