DCUN1D1 Antibody (3D7) - Azide and BSA Free

Western Blot: DCUN1D1 Antibody (3D7) [H00054165-M01] - DCUN1D1 monoclonal antibody (M01), clone 3D7. Analysis of DCUN1D1 expression in NIH/3T3.

Immunocytochemistry/Immunofluorescence: DCUN1D1 Antibody (3D7) [H00054165-M01] - Analysis of monoclonal antibody to DCUN1D1 on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: DCUN1D1 Antibody (3D7) [H00054165-M01] - DCUN1D1 monoclonal antibody (M01), clone 3D7. Analysis of DCUN1D1 expression in PC-12.

Western Blot: DCUN1D1 Antibody (3D7) [H00054165-M01] - DCUN1D1 monoclonal antibody (M01), clone 3D7 Analysis of DCUN1D1 expression in HepG2.

Western Blot: DCUN1D1 Antibody (3D7) [H00054165-M01] - DCUN1D1 monoclonal antibody (M01), clone 3D7. Analysis of DCUN1D1 expression in Raw 264.7.

Western Blot: DCUN1D1 Antibody (3D7) [H00054165-M01] - Analysis of DCUN1D1 expression in transfected 293T cell line by DCUN1D1 monoclonal antibody (M01), clone 3D7.Lane 1: DCUN1D1 transfected lysate(30.1 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 3D7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DCUN1D1 Antibody (3D7) - Azide and BSA Free Summary

• Immunogen: DCUN1D1 (NP_065691, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF
• Specificity: DCUN1D1 - DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DCUN1D1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DCUN1D1 Antibody (3D7) - Azide and BSA Free

• DCN1
• DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
• DCN1-like protein 1
• DCNL1
• DCUN1D1
• DCUN1L1
• DCUN1L1DCUN1 domain-containing protein 1
• Defective in cullin neddylation protein 1-like protein 1
• RP42 homolog
• RP42
• RP42Squamous cell carcinoma-related oncogene
• SCCRO
• SCCROSCRO
• Tes3

Background

DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-typecomplexes activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCUN1D1
• Entrez:
  • 54165(Human)
• OMIM:
  • 605905(Human)
• Uniprot:
  • NP_065691(Human)