U2AF2 Antibody (5G8)

Images

 
Western Blot: U2AF2 Antibody (5G8) [H00011338-M03] - Analysis of U2AF2 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: U2AF2 Antibody (5G8) [H00011338-M03] - Analysis of monoclonal antibody to U2AF2 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: U2AF2 Antibody (5G8) [H00011338-M03] - Detection limit for recombinant GST tagged U2AF2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
5G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

U2AF2 Antibody (5G8) Summary

Immunogen
U2AF2 (NP_001012496.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
Specificity
This product is specific for Human U2AF2 monoclonal antibody (M03), clone 5G8 [Gene ID: 11338].
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
U2AF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot
Application Notes
Mouse monoclonal antibody raised against a partial recombinant U2AF2.
Publications
Read Publication using H00011338-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for U2AF2 Antibody (5G8)

  • hU2AF(65)
  • hU2AF65
  • splicing factor U2AF 65 kD subunit
  • splicing factor U2AF 65 kDa subunit
  • U2 (RNU2) small nuclear RNA auxiliary factor 2
  • U2 auxiliary factor 65 kDa subunit
  • U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
  • U2 small nuclear RNA auxiliary factor 2
  • U2AF65U2 snRNP auxiliary factor large subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32515
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00007536-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-66861
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF6387
Species: Hu
Applications: WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NBP2-75656
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP1-57487
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-19997
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-04502
Species: Hu
Applications: ICC/IF, WB
NBP2-67094
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-79848
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00011338-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for U2AF2 Antibody (H00011338-M03)(1)


Showing Publication 1 - 1 of 1.
Publication using H00011338-M03 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for U2AF2 Antibody (H00011338-M03) (0)

There are no reviews for U2AF2 Antibody (H00011338-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for U2AF2 Antibody (H00011338-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional U2AF2 Products

Bioinformatics Tool for U2AF2 Antibody (H00011338-M03)

Discover related pathways, diseases and genes to U2AF2 Antibody (H00011338-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for U2AF2 Antibody (H00011338-M03)

Discover more about diseases related to U2AF2 Antibody (H00011338-M03).
 

Pathways for U2AF2 Antibody (H00011338-M03)

View related products by pathway.

PTMs for U2AF2 Antibody (H00011338-M03)

Learn more about PTMs related to U2AF2 Antibody (H00011338-M03).

Blogs on U2AF2

There are no specific blogs for U2AF2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our U2AF2 Antibody (5G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol U2AF2
Uniprot