U2AF2 Antibody (5G8) - Azide and BSA Free

Western Blot: U2AF2 Antibody (5G8) [H00011338-M03] - Analysis of U2AF2 expression in HepG2.

Immunocytochemistry/Immunofluorescence: U2AF2 Antibody (5G8) [H00011338-M03] - Analysis of monoclonal antibody to U2AF2 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: U2AF2 Antibody (5G8) [H00011338-M03] - Detection limit for recombinant GST tagged U2AF2 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 5G8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

U2AF2 Antibody (5G8) - Azide and BSA Free Summary

• Immunogen: U2AF2 (NP_001012496.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
• Specificity: This product is specific for Human U2AF2 monoclonal antibody (M03), clone 5G8 [Gene ID: 11338].
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: U2AF2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant U2AF2.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for U2AF2 Antibody (5G8) - Azide and BSA Free

• hU2AF(65)
• hU2AF65
• splicing factor U2AF 65 kD subunit
• splicing factor U2AF 65 kDa subunit
• U2 (RNU2) small nuclear RNA auxiliary factor 2
• U2 auxiliary factor 65 kDa subunit
• U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
• U2 small nuclear RNA auxiliary factor 2
• U2AF65U2 snRNP auxiliary factor large subunit

Background

U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for U2AF2 Antibody (H00011338-M03)(1)

Publication using H00011338-M03

• Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Bioinformatics

• Gene Symbol: U2AF2
• Uniprot:
  • NP_001012496.1(Human)