TZFP Antibody

Images

 
Western Blot: TZFP Antibody [H00027033-B01P] - Analysis of ZBTB32 expression in transfected 293T cell line by ZBTB32 polyclonal antibody. Lane 1: ZBTB32 transfected lysate(33.33 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: TZFP Antibody [H00027033-B01P] - Analysis of purified antibody to ZBTB32 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TZFP Antibody Summary

Immunogen
ZBTB32 (AAH17700, 1 a.a. - 302 a.a.) full-length human protein. MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPKQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRRTCNLCGS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ZBTB32
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
Application Notes
This antibody is useful for Western Blot, Functional, Immunofluorescence

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TZFP Antibody

  • Fanconi anemia zinc finger protein
  • FAXF
  • FAZFFANCC-interacting protein
  • Rog
  • Testis zinc finger protein
  • TZFPZinc finger protein 538
  • zinc finger and BTB domain containing 32
  • zinc finger and BTB domain-containing protein 32
  • ZNF538FAXFrepressor of GATA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2944
Species: Hu
Applications: Simple Western, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-77289
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-67451
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-43299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
M1300CB
Species: Mu
Applications: ELISA
NBP1-47663
Species: Hu
Applications: IHC, IHC-P, WB
H00002176-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
DY262
Species: Hu
Applications: ELISA
H00027033-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for TZFP Antibody (H00027033-B01P) (0)

There are no publications for TZFP Antibody (H00027033-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TZFP Antibody (H00027033-B01P) (0)

There are no reviews for TZFP Antibody (H00027033-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TZFP Antibody (H00027033-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TZFP Products

Bioinformatics Tool for TZFP Antibody (H00027033-B01P)

Discover related pathways, diseases and genes to TZFP Antibody (H00027033-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TZFP Antibody (H00027033-B01P)

View related products by pathway.

Blogs on TZFP

There are no specific blogs for TZFP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TZFP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB32
Uniprot