TWEAK/TNFSF12 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TNFSF12 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (81%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TWEAK/TNFSF12 Antibody - BSA Free
Background
CD266 is a 14 kD transmembrane protein known as TWEAK receptor (TWEAK-R) or fibroblast growth factor inducible 14 (Fn14). It is member 12A of the tumor necrosis factor receptor superfamily (TNFRSF12A) expressed at low levels in a variety of tissues, such as heart, placenta, lung, muscle, and pancreas. TWEAK-R binds TWEAK (CD255) and interacts with the cytoplasmic proteins TRAF1, 2, and 3. The engagement of Fn14 can induce cell death and may play a role in inflammation, hepatocyte growth, and liver neoplasia. ITEM-4 antibody reacts with both mouse and human Fn14. It is useful for flow cytometric analysis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Neut, WB
Species: Hu
Applications: ELISA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: Bind
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA
Publications for TWEAK/TNFSF12 Antibody (NBP2-46811) (0)
There are no publications for TWEAK/TNFSF12 Antibody (NBP2-46811).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TWEAK/TNFSF12 Antibody (NBP2-46811) (0)
There are no reviews for TWEAK/TNFSF12 Antibody (NBP2-46811).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for TWEAK/TNFSF12 Antibody (NBP2-46811) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TWEAK/TNFSF12 Products
Research Areas for TWEAK/TNFSF12 Antibody (NBP2-46811)
Find related products by research area.
|
Blogs on TWEAK/TNFSF12