TTC5 Antibody

Images

 
Western Blot: TTC5 Antibody [NBP1-53012] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTC5 Antibody Summary

Immunogen
Synthetic peptides corresponding to TTC5(tetratricopeptide repeat domain 5) The peptide sequence was selected from the C terminal of TTC5. Peptide sequence GDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNGKPQGSSSQAV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TTC5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TTC5 Antibody

  • Strap
  • tetratricopeptide repeat domain 5
  • tetratricopeptide repeat protein 5
  • TPR repeat protein 5

Background

TTC5 is an adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. It is required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. It prevents p53/TP53 degradation by MDM2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
27550002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
AF1936
Species: Hu
Applications: WB, IP
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for TTC5 Antibody (NBP1-53012) (0)

There are no publications for TTC5 Antibody (NBP1-53012).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC5 Antibody (NBP1-53012) (0)

There are no reviews for TTC5 Antibody (NBP1-53012). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC5 Antibody (NBP1-53012) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC5 Products

Bioinformatics Tool for TTC5 Antibody (NBP1-53012)

Discover related pathways, diseases and genes to TTC5 Antibody (NBP1-53012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC5 Antibody (NBP1-53012)

Discover more about diseases related to TTC5 Antibody (NBP1-53012).

Blogs on TTC5

There are no specific blogs for TTC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTC5
Uniprot