TTC11 Antibody (6S1G4)

Western Blot: TTC11 Antibody (6S1G4) [NBP3-15848] - Western blot analysis of extracts from normal (control) and TTC11 knockout (KO) HeLa cells, using TTC11 antibody (NBP3-15848) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunoprecipitation: TTC11 Antibody (6S1G4) [NBP3-15848] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug TTC11 antibody (NBP3-15848). Western blot was performed from the immunoprecipitate using TTC11 antibody (NBP3-15848) at a dilition of 1:1000.

Western Blot: TTC11 Antibody (6S1G4) [TTC11] - Western blot analysis of various lysates, using [KO Validated] TTC11 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunohistochemistry: TTC11 Antibody (6S1G4) [TTC11] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] TTC11 Rabbit mAb at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: TTC11 Antibody (6S1G4) [TTC11] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KO Validated] TTC11 Rabbit mAb at a dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: TTC11 Antibody (6S1G4) [TTC11] - Confocal imaging of U-2 OS cells using [KO Validated] TTC11 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP, KO
• Clone: 6S1G4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TTC11 Antibody (6S1G4) Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit TTC11 Antibody (6S1G4) (NBP3-15848) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11 (NP_057152.2).
  
  Sequence:
  MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: FIS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Knockout Validated
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TTC11 Antibody (6S1G4)

• CGI-135
• FIS1 homolog
• Fis1
• fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
• fission 1 (mitochondrial outer membrane) homolog (yeast)
• H_NH0132A01.6
• hFis1
• mitochondrial fission 1 protein
• tetratricopeptide repeat domain 11
• Tetratricopeptide repeat protein 11
• TTC11TPR repeat protein 11

Background

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: FIS1