TTC11 Antibody (6S1G4) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11 (NP_057152.2).
Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
FIS1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
- Knockout Validated
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TTC11 Antibody (6S1G4)
Background
The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, RNAi, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-Fr, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IP, KD, WB
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IP, KO
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for TTC11 Antibody (NBP3-15848) (0)
There are no publications for TTC11 Antibody (NBP3-15848).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TTC11 Antibody (NBP3-15848) (0)
There are no reviews for TTC11 Antibody (NBP3-15848).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TTC11 Antibody (NBP3-15848) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TTC11 Products
Research Areas for TTC11 Antibody (NBP3-15848)
Find related products by research area.
|
Blogs on TTC11