TSG-6 Antibody

Images

 
Western Blot: TSG-6 Antibody [NBP2-38637] - Analysis in human cell line PC-3 and human cell line HeLa.
Immunohistochemistry-Paraffin: TSG-6 Antibody [NBP2-38637] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: TSG-6 Antibody [NBP2-38637] - Staining of human fallopian tube shows moderate positivity in plasma.
Immunohistochemistry-Paraffin: TSG-6 Antibody [NBP2-38637] - Staining of human kidney shows strong positivity in apical membrane in cells in tubules.
Immunohistochemistry-Paraffin: TSG-6 Antibody [NBP2-38637] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells, as well as moderate positivity in plasma.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TSG-6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQ
Specificity
Specificity of human TSG-6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFAIP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TSG-6 Protein (NBP2-38637PEP)
Publications
Read Publication using
NBP2-38637 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TSG-6 Antibody

  • Hyaluronate-binding protein
  • TNF alpha-induced protein 6
  • TNFAIP6
  • TNF-stimulated gene 6 protein
  • TSG6
  • TSG-6
  • TSG-6tumor necrosis factor alpha-inducible protein 6
  • TSG6tumor necrosis factor-inducible gene 6 protein
  • Tumor necrosis factor alpha-induced protein 6
  • tumor necrosis factor, alpha-induced protein 6
  • tumor necrosis factor-stimulated gene-6 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-76910
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
AF3054
Species: Hu
Applications: WB, IHC, ICC
AF1265
Species: Mu
Applications: WB, IP, Neut
NBP2-75633
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
7270-IL/CF
Species: Hu
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-96910
Species: Hu
Applications: WB, PEP-ELISA
NB600-930
Species: Hu, Rt
Applications: WB, ELISA
NBP2-38770
Species: Hu, Mu
Applications: WB
AF1195
Species: Hu
Applications: WB, ELISA, IHC, Neut
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38637
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TSG-6 Antibody (NBP2-38637)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TSG-6 Antibody (NBP2-38637) (0)

There are no reviews for TSG-6 Antibody (NBP2-38637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TSG-6 Antibody (NBP2-38637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TSG-6 Products

Bioinformatics Tool for TSG-6 Antibody (NBP2-38637)

Discover related pathways, diseases and genes to TSG-6 Antibody (NBP2-38637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSG-6 Antibody (NBP2-38637)

Discover more about diseases related to TSG-6 Antibody (NBP2-38637).
 

Pathways for TSG-6 Antibody (NBP2-38637)

View related products by pathway.

PTMs for TSG-6 Antibody (NBP2-38637)

Learn more about PTMs related to TSG-6 Antibody (NBP2-38637).

Blogs on TSG-6

There are no specific blogs for TSG-6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TSG-6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFAIP6
Uniprot