TSC22/TSC22D1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TSC22/TSC22D1 Antibody [NBP2-54941] - Staining of human cell line A549 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSC22/TSC22D1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSC22D1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TSC22/TSC22D1 Recombinant Protein Antigen (NBP2-54941PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TSC22/TSC22D1 Antibody - BSA Free

• Cerebral protein 2
• Egr5
• KIAA1994
• MGC17597
• Regulatory protein TSC-22
• RP11-269C23.2
• TGFB1I4
• TGFB-stimulated clone 22 homolog
• transforming growth factor beta 1 induced transcript 4
• Transforming growth factor beta-1-induced transcript 4 protein
• transforming growth factor beta-stimulated protein TSC-22
• TSC22 domain family 1
• TSC22 domain family protein 1
• TSC22 domain family, member 1
• TSC22
• TSC22D1
• TSC22DKFZp686O19206

Background

Transforming growth factor-beta-stimulated clone-22 (TSC-22) acts as a transcriptionalregulator to modulate cell growth and differentiation and cell death. TSC-22 contains a leucine zipper domain as well as a nuclear export signal, resulting in cytoplasmic localization in living cells. However, concomitant with the induction of apoptosis, TSC-22 translocates from the cytoplasm to the nucleus and shows transcriptional regulatory activity. TSC-22 acts as a major downstream component in the TGF-beta pathway, and also the PPARgamma signalling pathway. The association of these two pathways with tumor suppression, and the significant downregulation of TSC-22 mRNA in various cancer types, such as brain and salivary gland tumors, imply an antiproliferative role for TSC-22.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSC22D1