TSC22/TSC22D1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TSC22D1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TSC22/TSC22D1 Antibody - BSA Free
Background
Transforming growth factor-beta-stimulated clone-22 (TSC-22) acts as a transcriptionalregulator to modulate cell growth and differentiation and cell death. TSC-22 contains a leucine zipper domain as well as a nuclear export signal, resulting in cytoplasmic localization in living cells. However, concomitant with the induction of apoptosis, TSC-22 translocates from the cytoplasm to the nucleus and shows transcriptional regulatory activity. TSC-22 acts as a major downstream component in the TGF-beta pathway, and also the PPARgamma signalling pathway. The association of these two pathways with tumor suppression, and the significant downregulation of TSC-22 mRNA in various cancer types, such as brain and salivary gland tumors, imply an antiproliferative role for TSC-22.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IP, KO, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, ChIP
Publications for TSC22/TSC22D1 Antibody (NBP2-54941) (0)
There are no publications for TSC22/TSC22D1 Antibody (NBP2-54941).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TSC22/TSC22D1 Antibody (NBP2-54941) (0)
There are no reviews for TSC22/TSC22D1 Antibody (NBP2-54941).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TSC22/TSC22D1 Antibody (NBP2-54941) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TSC22/TSC22D1 Products
Research Areas for TSC22/TSC22D1 Antibody (NBP2-54941)
Find related products by research area.
|
Blogs on TSC22/TSC22D1