TSC22D4 Antibody - BSA Free

Western Blot: TSC22D4 Antibody [NBP1-80688] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: TSC22D4 Antibody [NBP1-80688] - Staining of human cell line A-431 shows positivity in cytoplasm.

Immunohistochemistry-Paraffin: TSC22D4 Antibody [NBP1-80688] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: TSC22D4 Antibody [NBP1-80688] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TSC22D4 Antibody [NBP1-80688] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: TSC22D4 Antibody [NBP1-80688] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSC22D4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSC22D4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TSC22D4 Protein (NBP1-80688PEP)

Reactivity Notes

Mouse (82%), Rat (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSC22D4 Antibody - BSA Free

• THG1
• TILZ2THG-1
• TSC22 domain family 4
• TSC22 domain family protein 4
• TSC22 domain family, member 4
• Tsc-22-like protein THG-1
• TSC22-related-inducible leucine zipper protein 2

Background

TSC22D4 is a member of the TSC22 domain family of leucine zipper transcriptional regulators (see TSC22D3; MIM 300506) (Kester et al., 1999 [PubMed 10488076]; Fiorenza et al., 2001 [PubMed 11707329]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TSC22D4 Antibody (NBP1-80688)(3)

Publications using NBP1-80688

• Sharma K, Kumar S, Prakash R et al. Chebulinic acid alleviates LPS-induced inflammatory bone loss by targeting the crosstalk between reactive oxygen species/NF kappa B signaling in osteoblast cells Free radical biology & medicine 2022-11-21 [PMID: 36423891] (WB, Mouse)
• Yang B, Gelfanov VM, El K et al. Discovery of a potent GIPR peptide antagonist that is effective in rodent and human systems Molecular metabolism 2022-11-15 [PMID: 36400403]
• Homig-Holzel C, van Doorn R, Vogel C et al. Antagonistic TSC22D1 variants control BRAFE600-induced senescence. EMBO J 2011-05-04 [PMID: 21448135]

Bioinformatics

• Gene Symbol: TSC22D4
• Entrez:
  • 81628(Human)