Tryptophan hydroxylase 2 Antibody (2990)

Images

 
Immunohistochemistry-Paraffin: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of rat midbrain shows strong positivity in serotonin neurons in the dorsal raphe nucleus.
Immunohistochemistry-Paraffin: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of mouse brain shows moderate positivity in serotonergic fibers in the basal forebrain.
Immunohistochemistry-Paraffin: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of mouse brain shows moderate positivity in serotonergic fibers in the cerebral cortex.
Immunohistochemistry-Paraffin: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of human dorsal raphe nucleus shows strong cytoplasmic positivity in serotonin neurons.
Immunohistochemistry-Paraffin: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of human cerebral cortex shows moderate positivity in serotonergic neural fibers.
Immunohistochemistry-Paraffin: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of human kidney shows no positivity in cells in tubules or glomeruli as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clone
2990
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Tryptophan hydroxylase 2 Antibody (2990) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG
Specificity
Specificity of human, mouse, rat Tryptophan hydroxylase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
TPH2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tryptophan hydroxylase 2 Recombinant Protein Antigen (NBP2-46646PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Tryptophan hydroxylase 2 Antibody (2990)

  • ADHD7
  • EC 1.14.16
  • EC 1.14.16.4
  • FLJ37295
  • MGC138872
  • Neuronal tryptophan hydroxylase
  • NTPH
  • NTPHMGC138871
  • TPH2
  • tryptophan 5-hydroxylase 2
  • Tryptophan 5-monooxygenase 2
  • Tryptophan Hydroxylase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86922
Species: Hu
Applications: IHC, IHC-P
H00006532-D01P
Species: Hu, Mu
Applications: WB, Flow
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP2-55967
Species: Hu
Applications: ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-41273
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB300-174
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, IHC, IHC-P

Publications for Tryptophan hydroxylase 2 Antibody (NBP2-46646) (0)

There are no publications for Tryptophan hydroxylase 2 Antibody (NBP2-46646).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptophan hydroxylase 2 Antibody (NBP2-46646) (0)

There are no reviews for Tryptophan hydroxylase 2 Antibody (NBP2-46646). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tryptophan hydroxylase 2 Antibody (NBP2-46646) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

Discover related pathways, diseases and genes to Tryptophan hydroxylase 2 Antibody (NBP2-46646). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

Discover more about diseases related to Tryptophan hydroxylase 2 Antibody (NBP2-46646).
 

Pathways for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

View related products by pathway.

PTMs for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

Learn more about PTMs related to Tryptophan hydroxylase 2 Antibody (NBP2-46646).
 

Research Areas for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

Find related products by research area.

Blogs on Tryptophan hydroxylase 2

There are no specific blogs for Tryptophan hydroxylase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tryptophan hydroxylase 2 Antibody (2990) and receive a gift card or discount.

Bioinformatics

Gene Symbol TPH2
Entrez
Uniprot