Tryptophan hydroxylase 2 Antibody (2990)

Images

 
Immunohistochemistry: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Analysis of human kidney shows absence of immunoreactivity (negative control).
Immunohistochemistry: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of rat dorsal raphe shows strong immunoreactivity in serotonin neurons.
Immunohistochemistry: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of mouse basal forebrain shows strong immunoreactivity in serotonergic fibers.
Immunohistochemistry: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of human dorsal raphe shows strong immunoreactivity in serotonin neurons.
Immunohistochemistry: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of rat cerebral cortex shows positivity in serotonergic fibers.
Immunohistochemistry: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of mouse cerebral cortex shows positivity in serotonergic fibers.
Immunohistochemistry: Tryptophan hydroxylase 2 Antibody (2990) [NBP2-46646] - Staining of human cerebral cortex shows immunoreactivity in serotonergic fibers.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clone
2990
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Tryptophan hydroxylase 2 Antibody (2990) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
TPH2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Tryptophan hydroxylase 2 Antibody (2990)

  • ADHD7
  • EC 1.14.16
  • EC 1.14.16.4
  • FLJ37295
  • MGC138872
  • Neuronal tryptophan hydroxylase
  • NTPH
  • NTPHMGC138871
  • TPH2
  • tryptophan 5-hydroxylase 2
  • Tryptophan 5-monooxygenase 2
  • Tryptophan Hydroxylase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5276
Species: Hu
Applications: WB, IHC
NBP1-78989
Species: Mu, Rt
Applications: WB (-), IHC
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-55967
Species: Hu
Applications: ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
7570-GH
Species: Hu
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P

Publications for Tryptophan hydroxylase 2 Antibody (NBP2-46646) (0)

There are no publications for Tryptophan hydroxylase 2 Antibody (NBP2-46646).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptophan hydroxylase 2 Antibody (NBP2-46646) (0)

There are no reviews for Tryptophan hydroxylase 2 Antibody (NBP2-46646). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Tryptophan hydroxylase 2 Antibody (NBP2-46646) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tryptophan hydroxylase 2 Products

Bioinformatics Tool for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

Discover related pathways, diseases and genes to Tryptophan hydroxylase 2 Antibody (NBP2-46646). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

Discover more about diseases related to Tryptophan hydroxylase 2 Antibody (NBP2-46646).
 

Pathways for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

View related products by pathway.

PTMs for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

Learn more about PTMs related to Tryptophan hydroxylase 2 Antibody (NBP2-46646).
 

Research Areas for Tryptophan hydroxylase 2 Antibody (NBP2-46646)

Find related products by research area.

Blogs on Tryptophan hydroxylase 2

There are no specific blogs for Tryptophan hydroxylase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tryptophan hydroxylase 2 Antibody (2990) and receive a gift card or discount.

Bioinformatics

Gene Symbol TPH2
Entrez
Uniprot