TRPV5 Antibody - BSA Free

Western Blot: TRPV5 Antibody [NBP3-09268] - WB Suggested Anti-TRPV5 Antibody Titration: 0.2-1 ug/ml. Positive Control: 721_B cell lysate. TRPV5 is supported by BioGPS gene expression data to be expressed in 721_B

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TRPV5 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPV5 (NP_062815). Peptide sequence MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPV5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TRPV5 Antibody - BSA Free

• Calcium transport protein 2
• calcium transporter 2
• CAT2
• ECaC
• ECAC1
• ECAC1CaT2
• Epithelial calcium channel 1CAT2
• Osm-9-like TRP channel 3
• OTRPC3
• transient receptor potential cation channel subfamily V member 5
• transient receptor potential cation channel, subfamily V, member 5
• TRPV5

Background

TRPV5 is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRPV5