TRPM2 Recombinant Protein Antigen

Images

 
There are currently no images for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRPM2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRPM2.

Source: E. coli

Amino Acid Sequence: IKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRPM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51204.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TRPM2 Recombinant Protein Antigen

  • EC 3.6.1.13
  • EREG1MGC133383
  • Estrogen-responsive element-associated gene 1 protein
  • KNP3LTrpC-2
  • Long transient receptor potential channel 2
  • LTrpC2
  • LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2
  • NUDT9H
  • NUDT9L1
  • transient receptor potential cation channel, subfamily M, member 2
  • Transient receptor potential channel 7
  • TrpC7

Background

TRPM2 belongs to the ion transport protein family. This family contains Sodium, Potassium, Calcium and ion channels. This family has 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. TRPM2 is activated by oxidative stress and confers susceptibility to cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-77262
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
NB100-98844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-98864
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-12919
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-20989
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
NBP2-80537
Species: Mu
Applications: IHC, IHC-P, WB
NBP1-48036
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DCLU00
Species: Hu
Applications: ELISA
NBP2-58415
Species: Hu
Applications: IHC, IHC-P
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB100-1617
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-88493
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58306PEP
Species: Hu
Applications: AC

Publications for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP) (0)

There are no publications for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP) (0)

There are no reviews for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRPM2 Products

Array NBP2-58306PEP

Bioinformatics Tool for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP)

Discover related pathways, diseases and genes to TRPM2 Recombinant Protein Antigen (NBP2-58306PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP)

Discover more about diseases related to TRPM2 Recombinant Protein Antigen (NBP2-58306PEP).
 

Pathways for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP)

View related products by pathway.

PTMs for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP)

Learn more about PTMs related to TRPM2 Recombinant Protein Antigen (NBP2-58306PEP).
 

Research Areas for TRPM2 Recombinant Protein Antigen (NBP2-58306PEP)

Find related products by research area.

Blogs on TRPM2.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRPM2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPM2