TRPC1 Antibody (1E4) - Azide and BSA Free

ELISA: TRPC1 Antibody (1E4) [H00007220-M03-50ug] - Detection limit for recombinant GST tagged TRPC1 is 0.1 ng/ml as a capture antibody.

ELISA: TRPC1 Antibody (1E4) [H00007220-M03-50ug] - Detection limit for recombinant GST tagged TRPC1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 1E4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TRPC1 Antibody (1E4) - Azide and BSA Free Summary

• Immunogen: TRPC1 (NP_003295, 442 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGK
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRPC1
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRPC1 Antibody (1E4) - Azide and BSA Free

• HTRP-1
• MGC133334
• MGC133335
• transient receptor potential canonical 1
• transient receptor potential cation channel, subfamily C, member 1
• transient receptor potential channel 1
• Transient receptor protein 1
• TRP1
• TRP-1
• TRP1short transient receptor potential channel 1
• TRPC1

Background

The TRP1 (TRPC1) gene encodes for a short transient receptor potential channel 1 protein which creates non-selective channels permeable to calcium and other cations. The long isoform is 793 amino acids long at around 91 kDA while the short isoform is 759 amino acids at approximately 87 kDA. These proteins are believed to be operated by a phosphatidylinositol messenger system. The TRP1 gene interacts with MX1, CAV1, ITPR3, HOMER1, and BMPR2 genes in pathways for CREB transcription, intracellular calcium signaling, developmental biology and pancreatic secretion. The TRP1 gene has been studied in various diseases such as kidney disease, breast cancer, neuroblastoma, prostatius, retinitis, basal cell carcinoma, muscular dystrophy, gingivitis, hypoxia, cerebritis, neurodegeneration, pyloric stenosis, and bipolar disorder.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRPC1
• Entrez:
  • 7220(Human)
• OMIM:
  • 602343(Human)
• Uniprot:
  • NP_003295(Human)