TrkC Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TrkC Antibody [NBP2-55927] - Staining of human cell line U-2 OS shows localization to nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TrkC Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCI
Specificity
Specificity of human TrkC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NTRK3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TrkC Recombinant Protein Antigen (NBP2-55927PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TrkC Antibody

  • EC 2.7.10
  • EC 2.7.10.1
  • ETS related protein-neurotrophic receptor tyrosine kinase fusion protein
  • ETV6-NTRK3 fusion
  • gp145(trkC)
  • GP145-TrkC
  • Neurotrophic tyrosine kinase receptor type 3
  • neurotrophic tyrosine kinase, receptor, type 3
  • NT 3 receptor
  • NT-3 growth factor receptor
  • NTRK3
  • TrkC tyrosine kinase
  • TrkC
  • trk-C
  • TRKCneurotrophin 3 receptor
  • tyrosine kinase receptor C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007170-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
MAB367
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NB110-40561
Species: Hu
Applications: WB, IP
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi, S-ELISA
AF-303-NA
Species: Hu
Applications: WB, Neut
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NBP2-55927
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for TrkC Antibody (NBP2-55927) (0)

There are no publications for TrkC Antibody (NBP2-55927).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TrkC Antibody (NBP2-55927) (0)

There are no reviews for TrkC Antibody (NBP2-55927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TrkC Antibody (NBP2-55927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TrkC Products

Bioinformatics Tool for TrkC Antibody (NBP2-55927)

Discover related pathways, diseases and genes to TrkC Antibody (NBP2-55927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TrkC Antibody (NBP2-55927)

Discover more about diseases related to TrkC Antibody (NBP2-55927).
 

Pathways for TrkC Antibody (NBP2-55927)

View related products by pathway.

PTMs for TrkC Antibody (NBP2-55927)

Learn more about PTMs related to TrkC Antibody (NBP2-55927).
 

Research Areas for TrkC Antibody (NBP2-55927)

Find related products by research area.

Blogs on TrkC.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TrkC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NTRK3