TRF-1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRF-1. Source: E. coli Amino Acid Sequence: FLSKLQHGTQQQDLNKKERRVGTLQSTKKKKESRRATESRIPVSKSQPVTPE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TERF1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57285. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TRF-1 Recombinant Protein Antigen
Background
Telomeric repeat binding factor 1 (TRF1, TERF1, PIN2, TRBF1) and telomeric repeat binding factor 2 (TRF2, TERF2, TRBF2) are present at telomeres throughout the cell cycle, where they regulate telomerase by acting in cis to limit the elongation of individual chromosome ends. Telomerase adds hexameric repeats of TTAGGG to the ends of chromosomal DNA. This telomerase enzyme plays an influential role in cellular immortalization and cellular senescence. TRF1 negatively regulates telomere elongation, while TRF2 protects the chromosome ends by inhibiting end-to-end fusions. Downregulation of TRF expression in tumor cells may contribute to cell immortalization and malignant progression. TRF1 has an acidic N-terminus while TRF2 has a basic N-terminus. TRF2 localizes in the nucleolus at G0 and S and diffuses out of the nucleolus in G2 phase. During mitosis TRF2 disperses from the condensed chromosomes and returns to the nucleolus at cytokinesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Publications for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP) (0)
There are no publications for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP) (0)
There are no reviews for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP) (0)
Additional TRF-1 Products
Research Areas for TRF-1 Recombinant Protein Antigen (NBP2-57285PEP)
Find related products by research area.
|
Blogs on TRF-1