TRERF1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TRERF1 Antibody [NBP2-38883] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: TRERF1 Antibody [NBP2-38883] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: TRERF1 Antibody [NBP2-38883] - Staining in human testis and pancreas tissues using anti-TRERF1 antibody. Corresponding TRERF1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRERF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRERF1 Antibody - BSA Free (NBP2-38883) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHG
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRERF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRERF1 Protein (NBP2-38883PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRERF1 Antibody - BSA Free

• BCAR2
• Breast cancer estrogen resistance 2RAPAHSA277276
• dJ139D8.5
• FLJ21198
• rapa-1
• rapa-2
• RP1-139D8.5
• transcriptional regulating factor 1
• transcriptional regulating protein 132
• transcriptional-regulating factor 1
• Transcriptional-regulating protein 132
• TREP132
• TReP-132
• Zinc finger protein rapa
• Zinc finger transcription factor TReP-132

Background

The transcriptional regulating protein of 132 kDa (TReP-132/TRERF1) was identified as a transcription factor that interacts with and activates the promoter of the CYP11A1 gene, a gene that encodes cytochrome P450 side chain cleavage (P450scc) and catalyzes the first step in steroidgenesis. TRep-132 can function as a nuclear receptor co-activator and has been shown to interact with Sp1 and the progesterone receptor (PR) to suppress growth via activation of the gene promoters of the cyclin-dependent kinase inhibitors, p21 and p27.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRERF1
• Uniprot:
  • Q96PN7(Human)