BCAR3 Antibody - BSA Free

Western Blot: BCAR3 Antibody [NBP1-82523] - Analysis in human cell lines PC-3 and HEK293 using Anti-BCAR3 antibody. Corresponding BCAR3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: BCAR3 Antibody [NBP1-82523] - Staining of human cell line U-251 MG shows localization to plasma membrane, cytosol and centrosome.

Immunohistochemistry-Paraffin: BCAR3 Antibody [NBP1-82523] - Staining of human kidney shows moderate cytoplasmic positivity in tubular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BCAR3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BCAR3 Antibody - BSA Free (NBP1-82523) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCAR3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BCAR3 Protein (NBP1-82523PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BCAR3 Antibody - BSA Free

• breast cancer estrogen resistance 3
• dJ1033H22.2 (breast cancer estrogen resistance 3)
• KIAA0554
• Novel SH2-containing protein 2
• NSP2SH2D3Bbreast cancer estrogen resistance protein 3
• SH2 domain-containing protein 3B

Background

Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCAR3