Independent Antibodies: Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human cerebellum, fallopian tube, kidney and testis using Anti-TRAP1 antibody NBP2-47597 (A) shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: TRAP1 Antibody [NBP2-47597] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human kidney shows strong to very strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human cerebellum shows moderate to strong granular cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in seminiferous ducts.
Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human fallopian tube shows strong to very strong granular cytoplasmic positivity in glandular cells.
Western Blot: TRAP1 Antibody [NBP2-47597] - Analysis in human cell line CACO-2.
TRAP1 increased MIC60 protein levels of H9C2 cells via alleviating MIC60 ubiquitin-dependent degradation in extracellular acidosis.A, B RT-qPCR and western blot were used to determine the transfection efficiency of ...read more
TRAP1 interacted with MIC60 and decreased MIC60 ubiquitination to increase MIC60 protein levels in rats’ heart tissue in extracellular acidosis.A Detection of the colocalization of MIC60 (green) and TRAP1 (red) using ...read more
TRAP1 interacted with MIC60 and decreased MIC60 ubiquitination to increase MIC60 protein levels in rats’ heart tissue in extracellular acidosis.A Detection of the colocalization of MIC60 (green) and TRAP1 (red) using ...read more
TRAP1 interacted with MIC60 and decreased MIC60 ubiquitination to increase MIC60 protein levels in rats’ heart tissue in extracellular acidosis.A Detection of the colocalization of MIC60 (green) and TRAP1 (red) using ...read more
TRAP1 protected mitochondrial cristae and function by increasing MIC60 protein levels in extracellular acidosis.A Western blot was used to determine the transfection efficiency of TRAP1 and MIC60 in H9C2 cells. B Methyl ...read more
TRAP1 directly interacted with MIC60 in H9C2 cells.A Silver staining of TRAP1 immunoprecipitates. B LC-MS/MS of TRAP1 immunoprecipitates. C Representative fragmentation spectrum of the identified MIC60 peptides. D ...read more
This antibody was developed against a recombinant protein corresponding to amino acids: AMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRL
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for TRAP1 Antibody - BSA Free
HSP 75
HSP75TNFR-associated protein 1
HSP90Lheat shock protein 75 kDa, mitochondrial
TNF receptor-associated protein 1
TRAP-1
tumor necrosis factor type 1 receptor associated protein
Tumor necrosis factor type 1 receptor-associated protein
Background
The 90 kDa heat shock protein (hsp90) family of molecular chaperones is a highly conserved family of proteins that play an important physiological role. Hsp90 is involved in numerous cellular processes but is best known for its association with signal transduction machinery. A recently cloned homolog of hsp90 is TRAP1. Like hsp90, TRAP1 is found to be associated with numerous proteins involved in diverse actions. Immunofluorescence data has shown TRAP1 to be localized in the mitochondria of mammalian cells. This observation and the fact that TRAP1 is shown to have a mitochondrial targeting presequence strongly implicates TRAP1 as a mitochondrial matrix protein. Immunofluorescence staining of TRAP1 in PC-3-M cells with this antibody produces a pattern consistent with mitochondrial staining. Immunoprecipitation of TRAP1 using this antibody fails to co-precipitate p23, Hop, or CyP40 suggesting TRAP1®s inability to associate with these co-chaperones.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TRAP1 Antibody - BSA Free and receive a gift card or discount.