TRAP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human cerebellum, fallopian tube, kidney and testis using Anti-TRAP1 antibody NBP2-47597 (A) shows similar protein distribution across tissues to independent antibody NBP2-47598 (B).

Immunocytochemistry/Immunofluorescence: TRAP1 Antibody [NBP2-47597] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human kidney shows strong to very strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human cerebellum shows moderate to strong granular cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human testis shows moderate to strong granular cytoplasmic positivity in seminiferous ducts.

Immunohistochemistry-Paraffin: TRAP1 Antibody [NBP2-47597] - Staining of human fallopian tube shows strong to very strong granular cytoplasmic positivity in glandular cells.

Western Blot: TRAP1 Antibody [NBP2-47597] - Analysis in human cell line CACO-2.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRAP1 Antibody - BSA Free (NBP2-47597) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TRAP1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRL
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TRAP1 Protein (NBP2-47597PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRAP1 Antibody - BSA Free

• HSP 75
• HSP75TNFR-associated protein 1
• HSP90Lheat shock protein 75 kDa, mitochondrial
• TNF receptor-associated protein 1
• TRAP-1
• tumor necrosis factor type 1 receptor associated protein
• Tumor necrosis factor type 1 receptor-associated protein

Background

The 90 kDa heat shock protein (hsp90) family of molecular chaperones is a highly conserved family of proteins that play an important physiological role. Hsp90 is involved in numerous cellular processes but is best known for its association with signal transduction machinery. A recently cloned homolog of hsp90 is TRAP1. Like hsp90, TRAP1 is found to be associated with numerous proteins involved in diverse actions. Immunofluorescence data has shown TRAP1 to be localized in the mitochondria of mammalian cells. This observation and the fact that TRAP1 is shown to have a mitochondrial targeting presequence strongly implicates TRAP1 as a mitochondrial matrix protein. Immunofluorescence staining of TRAP1 in PC-3-M cells with this antibody produces a pattern consistent with mitochondrial staining. Immunoprecipitation of TRAP1 using this antibody fails to co-precipitate p23, Hop, or CyP40 suggesting TRAP1®s inability to associate with these co-chaperones.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRAP1 Antibody (NBP2-47597)(2)

Publications using NBP2-47597

• Zhang L, Luo Y, Lv L et al. TRAP1 inhibits MARCH5-mediated MIC60 degradation to alleviate mitochondrial dysfunction and apoptosis of cardiomyocytes under diabetic conditions Cell death and differentiation 2023-09-07 [PMID: 37679468]
• Zhang L, Su N, Luo Y et al. TRAP1 inhibits MIC60 ubiquitination to mitigate the injury of cardiomyocytes and protect mitochondria in extracellular acidosis Cell death discovery 2021-12-14 [PMID: 34907169] (ICC/IF, Rat)

Bioinformatics

• Gene Symbol: TRAP1