Translin Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit Translin Antibody - BSA Free (NBP3-35882) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Translin (NP_004613.1).
Sequence: GFQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TSN |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for Translin Antibody - BSA Free
Background
Translin, also designated testis brain RNA-binding protein (TB-RBP), is a single-stranded DNA- and RNA-binding protein that binds to the 3' UTR regions (Y and H elements) of stored mRNAs, which suppresses their in vitro translation. The human translin gene maps to chromosome 2q21.1 and encodes a 26 kDa protein that has been highly conserved throughout evolution. Translin forms a ring-shaped structure, which is responsible for DNA binding, and also contains a leucine zipper motif, which is thought to enable translin to form dimers. Translin exports specific mRNAs out of the nucleus, supported by its localization in both the nuclei and cytoplasm of neurons, and regulates their translation. Association with Trax (translin-associated factor X), inhibits the binding of translin to RNA, but enhances its binding to single stranded DNA sequences. Breakpoints in the TLS/FUS and CHOP loci contain consensus recognition motifs of translin, which associates with chromosomal translocations in liposarcomas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Publications for Translin Antibody (NBP3-35882) (0)
There are no publications for Translin Antibody (NBP3-35882).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Translin Antibody (NBP3-35882) (0)
There are no reviews for Translin Antibody (NBP3-35882).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Translin Antibody (NBP3-35882) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Translin Products
Blogs on Translin