Protamine 2 Antibody


Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human fallopian tube shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining in human testis and fallopian tube tissues using anti-PRM2 antibody. Corresponding PRM2 RNA-seq data are more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Protamine 2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQS
Specificity of human Protamine 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Protamine 2 Protein (NBP2-31637PEP)
Read Publication using NBP2-31637.

Reactivity Notes

Species Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Protamine 2 Antibody

  • cancer/testis antigen family 94, member 2
  • CT94.2
  • FLJ27447
  • protamine 2
  • protamine-2
  • Sperm histone P2
  • Sperm protamine P2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P

Publications for Protamine 2 Antibody (NBP2-31637)(1)

Reviews for Protamine 2 Antibody (NBP2-31637) (0)

There are no reviews for Protamine 2 Antibody (NBP2-31637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Protamine 2 Antibody (NBP2-31637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Protamine 2 Antibody (NBP2-31637)

Discover related pathways, diseases and genes to Protamine 2 Antibody (NBP2-31637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protamine 2 Antibody (NBP2-31637)

Discover more about diseases related to Protamine 2 Antibody (NBP2-31637).

Pathways for Protamine 2 Antibody (NBP2-31637)

View related products by pathway.

PTMs for Protamine 2 Antibody (NBP2-31637)

Learn more about PTMs related to Protamine 2 Antibody (NBP2-31637).

Blogs on Protamine 2

There are no specific blogs for Protamine 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Protamine 2 Antibody and receive a gift card or discount.


Gene Symbol PRM2