Protamine 2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Analysis in human testis and fallopian tube tissues. Corresponding Protamine 2 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human testis shows strong nuclear positivity in spermatids.
Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human fallopian tube shows low expression as expected.
Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human prostate shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Protamine 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Protamine 2 Protein (NBP2-31637PEP)
Publications
Read Publications using
NBP2-31637 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Species Reactivity reported in scientific literature (PMID: 24598113).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Protamine 2 Antibody

  • cancer/testis antigen family 94, member 2
  • CT94.2
  • FLJ27447
  • protamine 2
  • protamine-2
  • Sperm histone P2
  • Sperm protamine P2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-07755
Species: Hu
Applications: WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP2-30567
Species: Hu
Applications: IHC, IHC-P
H00001390-M02
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
H00001617-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-76581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-77285
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-31637
Species: Hu
Applications: IHC, IHC-P

Publications for Protamine 2 Antibody (NBP2-31637)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP2-31637 Applications Species
Djureinovic D, Fagerberg L, Hallstrom B et al. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Mol Hum Reprod 2014 Jun [PMID: 24598113]
Flannigan R, Mielnik A, Robinson B et al. YBX2 Dysregulation is a Potential Cause for Late Maturation Arrest in Men with Non-Obstructive Azoospermia. bioRxiv Jul 9 2018 (IHC, Human) IHC Human

Reviews for Protamine 2 Antibody (NBP2-31637) (0)

There are no reviews for Protamine 2 Antibody (NBP2-31637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Protamine 2 Antibody (NBP2-31637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protamine 2 Products

Bioinformatics Tool for Protamine 2 Antibody (NBP2-31637)

Discover related pathways, diseases and genes to Protamine 2 Antibody (NBP2-31637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protamine 2 Antibody (NBP2-31637)

Discover more about diseases related to Protamine 2 Antibody (NBP2-31637).
 

Pathways for Protamine 2 Antibody (NBP2-31637)

View related products by pathway.

PTMs for Protamine 2 Antibody (NBP2-31637)

Learn more about PTMs related to Protamine 2 Antibody (NBP2-31637).

Blogs on Protamine 2

There are no specific blogs for Protamine 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protamine 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRM2
Uniprot