TRAX Antibody

Images

 
Western Blot: TRAX Antibody [NBP1-80665] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-594
Immunohistochemistry-Paraffin: TRAX Antibody [NBP1-80665] - Staining of human testis shows strong cytoplasmic positivity in basal cells of seminiferous tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVK
Specificity
Specificity of human TRAX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSNAX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
TRAX Lysate (NBP2-65207)
Control Peptide
TRAX Protein (NBP1-80665PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAX Antibody

  • DISC1
  • translin-associated factor Xdisrupted in schizophrenia 1
  • translin-like protein
  • TRAXtranslin-associated protein X

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76581
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP1-91953
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02956
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-14971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
7815-NG/CF
Species: Rt
NBP1-83754
Species: Hu
Applications: IHC, IHC-P
NBP1-80665
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TRAX Antibody (NBP1-80665) (0)

There are no publications for TRAX Antibody (NBP1-80665).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAX Antibody (NBP1-80665) (0)

There are no reviews for TRAX Antibody (NBP1-80665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAX Antibody (NBP1-80665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TRAX Antibody (NBP1-80665)

Discover related pathways, diseases and genes to TRAX Antibody (NBP1-80665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAX Antibody (NBP1-80665)

Discover more about diseases related to TRAX Antibody (NBP1-80665).
 

Pathways for TRAX Antibody (NBP1-80665)

View related products by pathway.

PTMs for TRAX Antibody (NBP1-80665)

Learn more about PTMs related to TRAX Antibody (NBP1-80665).

Blogs on TRAX

There are no specific blogs for TRAX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSNAX