Translin Antibody


Western Blot: Translin Antibody [NBP2-31779] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Translin Antibody [NBP2-31779] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts, Leydig cells showed moderate nuclear staining.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Translin Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGF
Specificity of human Translin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Translin Lysate (NBP2-64624)
Control Peptide
Translin Protein (NBP2-31779PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Translin Antibody

  • BCLF-1
  • RCHF1
  • recombination hotspot associated factor
  • recombination hotspot-binding protein
  • REHF-1
  • translin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Translin Antibody (NBP2-31779) (0)

There are no publications for Translin Antibody (NBP2-31779).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Translin Antibody (NBP2-31779) (0)

There are no reviews for Translin Antibody (NBP2-31779). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Translin Antibody (NBP2-31779) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Translin Products

Bioinformatics Tool for Translin Antibody (NBP2-31779)

Discover related pathways, diseases and genes to Translin Antibody (NBP2-31779). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Translin Antibody (NBP2-31779)

Discover more about diseases related to Translin Antibody (NBP2-31779).

Pathways for Translin Antibody (NBP2-31779)

View related products by pathway.

PTMs for Translin Antibody (NBP2-31779)

Learn more about PTMs related to Translin Antibody (NBP2-31779).

Blogs on Translin

There are no specific blogs for Translin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Translin Antibody and receive a gift card or discount.


Gene Symbol TSN