Translin Antibody - BSA Free

Western Blot: Translin Antibody [NBP2-31779] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: Translin Antibody [NBP2-31779] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts, Leydig cells showed moderate nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Translin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Translin Antibody - BSA Free (NBP2-31779) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGF
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Translin Protein (NBP2-31779PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Translin Antibody - BSA Free

• BCLF-1
• RCHF1
• recombination hotspot associated factor
• recombination hotspot-binding protein
• REHF-1
• TBRBP
• translin
• TRSLN

Background

Translin, also designated testis brain RNA-binding protein (TB-RBP), is a single-stranded DNA- and RNA-binding protein that binds to the 3' UTR regions (Y and H elements) of stored mRNAs, which suppresses their in vitro translation. The human translin gene maps to chromosome 2q21.1 and encodes a 26 kDa protein that has been highly conserved throughout evolution. Translin forms a ring-shaped structure, which is responsible for DNA binding, and also contains a leucine zipper motif, which is thought to enable translin to form dimers. Translin exports specific mRNAs out of the nucleus, supported by its localization in both the nuclei and cytoplasm of neurons, and regulates their translation. Association with Trax (translin-associated factor X), inhibits the binding of translin to RNA, but enhances its binding to single stranded DNA sequences. Breakpoints in the TLS/FUS and CHOP loci contain consensus recognition motifs of translin, which associates with chromosomal translocations in liposarcomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSN
• Uniprot:
  • Q15631(Human)